Potri.015G031700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14819 75 / 7e-19 Protein of unknown function (DUF1677) (.1)
AT3G22540 71 / 3e-17 Protein of unknown function (DUF1677) (.1)
AT1G79770 69 / 3e-16 Protein of unknown function (DUF1677) (.1)
AT5G20670 69 / 6e-16 Protein of unknown function (DUF1677) (.1)
AT1G72510 68 / 1e-15 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2)
AT5G25840 64 / 7e-14 Protein of unknown function (DUF1677) (.1)
AT1G54095 62 / 1e-13 Protein of unknown function (DUF1677) (.1)
AT2G25780 60 / 1e-12 Protein of unknown function (DUF1677) (.1)
AT2G09970 57 / 2e-11 Protein of unknown function (DUF1677) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G219100 82 / 2e-21 AT1G72510 131 / 7e-40 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2)
Potri.010G086000 79 / 2e-20 AT4G14819 136 / 3e-43 Protein of unknown function (DUF1677) (.1)
Potri.001G166900 79 / 1e-19 AT1G72510 190 / 2e-62 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2)
Potri.012G042000 75 / 1e-19 AT5G20670 39 / 2e-05 Protein of unknown function (DUF1677) (.1)
Potri.008G154500 76 / 3e-19 AT3G22540 133 / 1e-41 Protein of unknown function (DUF1677) (.1)
Potri.003G050200 75 / 5e-18 AT5G25840 152 / 3e-47 Protein of unknown function (DUF1677) (.1)
Potri.001G188700 74 / 1e-17 AT1G79770 157 / 2e-49 Protein of unknown function (DUF1677) (.1)
Potri.003G067800 73 / 1e-17 AT1G72510 194 / 5e-64 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2)
Potri.006G140600 63 / 7e-14 AT5G20670 147 / 5e-46 Protein of unknown function (DUF1677) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015670 81 / 8e-21 AT1G72510 139 / 7e-43 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2)
Lus10013156 81 / 1e-20 AT1G72510 157 / 2e-49 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2)
Lus10037683 81 / 1e-20 AT1G72510 134 / 2e-40 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2)
Lus10008118 80 / 5e-20 AT1G72510 157 / 1e-49 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2)
Lus10010564 73 / 9e-18 AT3G22540 151 / 1e-48 Protein of unknown function (DUF1677) (.1)
Lus10006107 72 / 2e-17 AT3G22540 155 / 2e-50 Protein of unknown function (DUF1677) (.1)
Lus10011427 70 / 4e-16 AT5G25840 172 / 5e-55 Protein of unknown function (DUF1677) (.1)
Lus10037569 68 / 2e-15 AT5G25840 173 / 1e-55 Protein of unknown function (DUF1677) (.1)
Lus10000571 68 / 3e-15 AT5G25840 174 / 9e-56 Protein of unknown function (DUF1677) (.1)
Lus10006044 67 / 3e-15 AT5G25840 175 / 2e-56 Protein of unknown function (DUF1677) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07911 DUF1677 Protein of unknown function (DUF1677)
Representative CDS sequence
>Potri.015G031700.1 pacid=42775584 polypeptide=Potri.015G031700.1.p locus=Potri.015G031700 ID=Potri.015G031700.1.v4.1 annot-version=v4.1
ATGGCTGGTGGAGAGGTGGTGGAGAGAGCTGAGTGTGGGTGCTGTGGTATGCGGGAAGAGTGCACAATGGGATACATAGGTTGGGTGCAGGAGAGGTTTG
GTGGGGTGTGGGTGTGTGGTCTTTGTGAGGAAGCAATCAAGGATGAGCAAACAAGGTTAGGAGTGGGAGTTGAAGTTGCTTTGAGGATTCATGCCACATT
CAGAGAGACTGCAAATGCTGATCCTCCCATTCACGTAGCTCAATCCATTCTCCAACTCATCAAGAAGATCATGTCCTCCACTTCTTCTTCACCCAACTAA
AA sequence
>Potri.015G031700.1 pacid=42775584 polypeptide=Potri.015G031700.1.p locus=Potri.015G031700 ID=Potri.015G031700.1.v4.1 annot-version=v4.1
MAGGEVVERAECGCCGMREECTMGYIGWVQERFGGVWVCGLCEEAIKDEQTRLGVGVEVALRIHATFRETANADPPIHVAQSILQLIKKIMSSTSSSPN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G14819 Protein of unknown function (D... Potri.015G031700 0 1
Potri.005G187000 6.78 0.7148
Potri.008G225101 24.55 0.7041
Potri.008G224156 29.05 0.6906
Potri.008G224310 34.29 0.6885
AT5G14280 GeBP DNA-binding storekeeper protei... Potri.010G056000 37.66 0.6794
Potri.008G225501 39.77 0.6871
Potri.008G224901 43.26 0.6831
ATMG00640 ATMG00640.1, OR... hydrogen ion transporting ATP ... Potri.007G062422 45.78 0.6849
AT1G58122 CPuORF45 conserved peptide upstream ope... Potri.007G113150 45.78 0.6728
AT2G38770 EMB2765 EMBRYO DEFECTIVE 2765, P-loop ... Potri.001G024401 47.33 0.5668

Potri.015G031700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.