Plant FIBer expression Database

Pt-RPS4.2 (Potri.015G033700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-RPS4.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17360 468 / 3e-169 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
AT5G07090 468 / 3e-169 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
AT5G58420 467 / 5e-169 Ribosomal protein S4 (RPS4A) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G124100
[exp]
489 / 2e-177 AT5G58420 458 / 2e-165 Ribosomal protein S4 (RPS4A) family protein (.1)
Potri.006G103700
[exp]
489 / 2e-177 AT5G58420 465 / 3e-168 Ribosomal protein S4 (RPS4A) family protein (.1)
Potri.013G011000
[exp]
488 / 4e-177 AT2G17360 452 / 6e-163 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Potri.015G079600
[exp]
484 / 2e-175 AT5G07090 460 / 4e-166 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004272
[exp]
450 / 3e-162 AT5G58420 499 / 0.0 Ribosomal protein S4 (RPS4A) family protein (.1)
Lus10019239
[exp]
451 / 2e-153 AT2G22660 747 / 0.0 Protein of unknown function (duplicated DUF1399) (.1), Protein of unknown function (duplicated DUF1399) (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF00467 KOW KOW motif
CL0021 OB PF00900 Ribosomal_S4e Ribosomal family S4e
CL0492 S4 PF01479 S4 S4 domain
CL0492 PF08071 RS4NT RS4NT (NUC023) domain
CL0492 PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus
Representative CDS sequence
>Potri.015G033700.1 pacid=42776162 polypeptide=Potri.015G033700.1.p locus=Potri.015G033700 ID=Potri.015G033700.1.v4.1 annot-version=v4.1
ATGGCTAGAGGGTTGAAGAAACACTTGAAGAGGCTCAATGCTCCTAAACATTGGATGCTTGACAAACTTGGTGGTGCATTTGCACCCAAGCCCTCATCTG
GACCCCACAAATCTAGGGAATGCTTGCCTCTGATTCTTATTCTGCGAAACAGGCTGAAATATGCTTTGACATACCGTGAAGTGATTGCTATTTTGATGCA
GAGACATGTCCTTGTTGATGGGAAGGTCAGGACAGATAAAACTTACCCATCTGGTTTCATGGATGTTGTGTCAATCCCAAAGACAAATGAGAGCTTCCGT
CTCCTCTATGACACCAAAGGCCGCTTCCGGCTCCACTCACTCAGAGATGATGAGGCCAAGTTTAAGCTTTGCAAAGTTCGGTCTATTCAGTTTGGGCAGA
AAGGAATCCCTTACCTGAACACCTATGATGGGCGCACCATCCGCTACCCAGATCCCCTCATCAAGGCCAATGACACCATCAAGCTGGACCTAGAGAACAA
CAAAATAGTTGACTTCATCAAGTTTGATGTGGGAAATGTTGTCATGGTCACTGGAGGAAGGAACAGAGGCCGAGTTGGAGTAATCAAGAACAGGGAGAAG
CATAAGGGCAGCTTTGAGACAATCCATGTCCAAGATGCCACTGGCCATGAGTTTGCCACCCGCTTGGGCAATGTGTTCACCATTGGAAAGGGCACCAAGC
CATGGATTTCTCTTCCCAAGGGTAAGGGTATCAAGTTGTCTATCATTGAGGAGGCTAGAAAGAGGCTTGCAGCATCCCAAGCTACTGCATGA
AA sequence
>Potri.015G033700.1 pacid=42776162 polypeptide=Potri.015G033700.1.p locus=Potri.015G033700 ID=Potri.015G033700.1.v4.1 annot-version=v4.1
MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFR
LLYDTKGRFRLHSLRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREK
HKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRLAASQATA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07090 Ribosomal protein S4 (RPS4A) f... Potri.015G033700
[exp]
0 1 Pt-RPS4.2
AT2G18110 Translation elongation factor... Potri.001G224700
[exp]
1.00 0.9255
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Potri.010G210300
[exp]
2.00 0.9016 ATRPL23.2
AT5G59850 Ribosomal protein S8 family pr... Potri.010G208700
[exp]
5.00 0.8964 Pt-WRP15.1
AT1G07070 Ribosomal protein L35Ae family... Potri.010G199400
[exp]
6.48 0.9166
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.002G099500
[exp]
8.94 0.8890
AT2G19740 Ribosomal protein L31e family ... Potri.018G070100
[exp]
11.09 0.9056
AT3G05590 RPL18 ribosomal protein L18 (.1) Potri.002G202800
[exp]
11.22 0.8729 RPL18.9
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Potri.009G158700
[exp]
19.74 0.8635 Pt-RPL30.2
AT4G18100 Ribosomal protein L32e (.1) Potri.014G191000
[exp]
21.44 0.8723
AT2G19740 Ribosomal protein L31e family ... Potri.009G064100
[exp]
25.29 0.8740

Potri.015G033700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.