Plant FIBer expression Database

Potri.015G036201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18280 96 / 3e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G73550 84 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT1G73560 71 / 4e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G62790 60 / 7e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT1G70250 60 / 5e-11 receptor serine/threonine kinase, putative (.1)
AT5G13900 52 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12360 43 / 1e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G18280 39 / 0.0002 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G44290 39 / 0.0007 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G119000
[exp]
62 / 1e-12 AT1G62790 90 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.003G113900
[exp]
62 / 2e-12 AT1G70250 73 / 9e-16 receptor serine/threonine kinase, putative (.1)
Potri.013G131500
[exp]
51 / 1e-08 AT5G13900 122 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G232000
[exp]
39 / 0.0004 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032228
[exp]
60 / 9e-12 AT1G70250 90 / 1e-23 receptor serine/threonine kinase, putative (.1)
Lus10024591
[exp]
59 / 2e-11 AT1G62790 100 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10031335
[exp]
58 / 4e-10 AT3G17910 414 / 3e-142 SURFEIT 1, EMBRYO DEFECTIVE 3121, Surfeit locus 1 cytochrome c oxidase biogenesis protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF14368 LTP_2 Probable lipid transfer
Representative CDS sequence
>Potri.015G036201.1 pacid=42775950 polypeptide=Potri.015G036201.1.p locus=Potri.015G036201 ID=Potri.015G036201.1.v4.1 annot-version=v4.1
ATGGATTCGAAGACCACGTTGAGTTTCTTTCTGATCTTCTCATCATGTGTCTTTCTAGGGTTTTCAGGAGGTGAGGCTCTAGAAATGTCATGTATACAAA
ATCTGCTTCCATGTAAACCCTATTTACCAGGAACCGAGCCGCCGCCACCTGTTTGCTGCTTGCCACTGAAGGACATGGTCGCACATCAAGCTCAGTGTCT
TTGCAGTGCTTTAGCAAATCCAGATCTCCTGAAGGATTTCAACGTCACCATGGATGGTGCCCTTAAGCTTGCCAAGACTTGTGGCGCCTCAGTTGACATG
TCTGTTTGCAAAAATGCAACATCTCCATCAGGTTCTCCGGCAAAGCCATCAACTCCTACCACCAATGCAACAACTCCAAGTGGTTCCAACACAACTCCAA
AAAGTGCAGCAAATTATGAGATCGCTCACTTTGGAGGATCTGGTTTCGTTGCTGCTATCTTTCTGGGTTTGATTTTTTCCATGTTGTAA
AA sequence
>Potri.015G036201.1 pacid=42775950 polypeptide=Potri.015G036201.1.p locus=Potri.015G036201 ID=Potri.015G036201.1.v4.1 annot-version=v4.1
MDSKTTLSFFLIFSSCVFLGFSGGEALEMSCIQNLLPCKPYLPGTEPPPPVCCLPLKDMVAHQAQCLCSALANPDLLKDFNVTMDGALKLAKTCGASVDM
SVCKNATSPSGSPAKPSTPTTNATTPSGSNTTPKSAANYEIAHFGGSGFVAAIFLGLIFSML

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G18280 Bifunctional inhibitor/lipid-t... Potri.015G036201
[exp]
0 1
AT5G20310 Adenine nucleotide alpha hydro... Potri.018G147200
[exp]
2.00 0.9813
AT4G27410 NAC RD26, ANAC072 NAC (No Apical Meristem) domai... Potri.009G052200
[exp]
2.23 0.9569
Potri.010G095050
[exp]
8.66 0.9413
Potri.008G040200
[exp]
9.16 0.9168
Potri.004G174850
[exp]
10.86 0.8956
AT3G19090 RNA-binding protein (.1) Potri.004G144700
[exp]
12.48 0.8607
AT2G33670 ATMLO5, MLO5 MILDEW RESISTANCE LOCUS O 5, S... Potri.005G254800
[exp]
13.07 0.9765
AT1G09380 nodulin MtN21 /EamA-like trans... Potri.005G006600
[exp]
16.37 0.9749
Potri.010G096850
[exp]
20.83 0.9523
Potri.009G054450
[exp]
21.90 0.8942

Potri.015G036201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.