Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73640 331 / 2e-116 AtRABA6a RAB GTPase homolog A6A (.1) AT1G18200 321 / 2e-112 AtRABA6b RAB GTPase homolog A6B (.1) AT5G45750 264 / 4e-90 AtRABA1c RAB GTPase homolog A1C (.1) AT4G18800 261 / 3e-89 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT5G60860 258 / 6e-88 AtRABA1f RAB GTPase homolog A1F (.1) AT3G15060 258 / 2e-87 AtRABA1g RAB GTPase homolog A1G (.1) AT1G07410 257 / 2e-87 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT2G33870 256 / 8e-87 ArRABA1h RAB GTPase homolog A1H (.1) AT3G46830 255 / 1e-86 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1) AT1G16920 254 / 4e-86 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G374000 [exp] 270 / 2e-92 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.011G061300 [exp] 264 / 4e-90 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1) Potri.019G092500 [exp] 263 / 6e-90 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.004G061000 [exp] 261 / 7e-89 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.006G000300 [exp] 260 / 1e-88 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.013G123600 [exp] 259 / 3e-88 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.011G070300 [exp] 259 / 3e-88 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.010G197200 [exp] 255 / 1e-86 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.016G000400 [exp] 250 / 9e-85 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018013 [exp] 283 / 3e-97 AT1G18200 275 / 9e-94 RAB GTPase homolog A6B (.1) Lus10042009 [exp] 281 / 1e-96 AT1G18200 276 / 1e-94 RAB GTPase homolog A6B (.1) Lus10029253 [exp] 267 / 4e-91 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10007306 [exp] 267 / 4e-91 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1) Lus10002178 [exp] 262 / 3e-89 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10017679 [exp] 261 / 5e-89 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1) Lus10025432 [exp] 261 / 9e-89 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10013961 [exp] 259 / 2e-88 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1) Lus10015297 [exp] 259 / 3e-88 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10016486 [exp] 256 / 5e-87 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.015G039700.1 pacid=42774776 polypeptide=Potri.015G039700.1.p locus=Potri.015G039700 ID=Potri.015G039700.1.v4.1 annot-version=v4.1 ATGGCTGATTCATATGATGAAGAGTGTGATTATCTTTTTAAAGCAGTTCTTATCGGAGACTCTGCAGTTGGGAAATCAAATCTTCTATCAAGGTTTTCCA GAGACGAATTCCGGTTAGATTCTAAGCCAACTATAGGGGTTGAATTTGCTTACCGGAATATAAGAGTTGGTGATAAGCTCATCAAGGCTCAAATATGGGA CACCGCTGGCCAAGAAAGGTTTAGAGCTATTACCAGTTCTTACTACCGTGGGGCTCTAGGTGCGTTGCTGGTTTATGACATTACAAGGAGAGCAACGTTT GACAATGTGAAAAAATGGTTGCATGAGCTAAGAGACTTTGGTAGCTCAGATATGGTCGTTGTTCTCGTCGGAAATAAATCTGATATTAGTCATCTTAGAG AAGTTGATGAAGATGATGGTAAGAACCTTGCAGAGACCGAAGCTTTGTACTTCATGGAAACATCAGCGTTGGAGAATTTGAACGTGGAGGAAGCTTTCAT GCAAATGATCACCAGAATCCATGAAATCGCAAGCCAAAAAAGCTTGGAGGCTAAGAAGAACGAAACAACAATTTCTACCATAAAGGCTCTTCCGGTGGGA AAAGAAGTGATTAATATTGATGATGAGGTATCTGCAACTAAACAAGCTAGTTATTGCTGTTCATATTAA
AA sequence Show only first row Show all	>Potri.015G039700.1 pacid=42774776 polypeptide=Potri.015G039700.1.p locus=Potri.015G039700 ID=Potri.015G039700.1.v4.1 annot-version=v4.1 MADSYDEECDYLFKAVLIGDSAVGKSNLLSRFSRDEFRLDSKPTIGVEFAYRNIRVGDKLIKAQIWDTAGQERFRAITSSYYRGALGALLVYDITRRATF DNVKKWLHELRDFGSSDMVVVLVGNKSDISHLREVDEDDGKNLAETEALYFMETSALENLNVEEAFMQMITRIHEIASQKSLEAKKNETTISTIKALPVG KEVINIDDEVSATKQASYCCSY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G73640		AtRABA6a	RAB GTPase homolog A6A (.1)		Potri.015G039700 [exp]	0	1
AT2G31945			unknown protein		Potri.003G215300 [exp]	2.00	0.8322
					Potri.019G129820 [exp]	2.64	0.8341
AT1G23160			Auxin-responsive GH3 family pr...		Potri.014G136800 [exp]	6.00	0.7742
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Potri.001G248700 [exp]	6.00	0.7724
AT2G17760			Eukaryotic aspartyl protease f...		Potri.005G108700 [exp]	6.32	0.8099
					Potri.019G129200 [exp]	8.36	0.7636
AT4G29950			Ypt/Rab-GAP domain of gyp1p su...		Potri.006G076000 [exp]	8.48	0.7208
					Potri.019G129150 [exp]	8.66	0.8227
AT1G19300		ATGATL1, GATL1,...	PARVUS, GAOLAOZHUANGREN 1, GAL...		Potri.002G132900 [exp]	10.09	0.8043
AT5G03760		ATCSLA9, RAT4, ...	RESISTANT TO AGROBACTERIUM TRA...		Potri.010G234100 [exp]	11.22	0.7965	MANS.2

Compare expression of checked genes

Potri.015G039700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.