Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	E12A11.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18100 291 / 2e-102 MFT, E12A11 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT5G03840 179 / 5e-58 TFL-1, TFL1 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT2G27550 177 / 2e-57 ATC centroradialis (.1) AT5G62040 175 / 2e-56 BFT brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT4G20370 162 / 3e-51 TSF TWIN SISTER OF FT, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT1G65480 160 / 1e-50 FT FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G165100 [exp] 179 / 4e-58 AT2G27550 293 / 7e-103 centroradialis (.1) Potri.004G203900 [exp] 178 / 1e-57 AT2G27550 286 / 4e-100 centroradialis (.1) Potri.010G179700 [exp] 172 / 2e-55 AT1G65480 286 / 2e-100 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.008G077700 [exp] 172 / 4e-55 AT1G65480 257 / 8e-89 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.015G141300 [exp] 122 / 6e-36 AT5G62040 217 / 1e-73 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179900 [exp] 97 / 1e-26 AT1G65480 132 / 6e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179801 [exp] 97 / 2e-26 AT1G65480 133 / 3e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002592 [exp] 211 / 1e-70 AT1G18100 207 / 6e-69 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10018417 [exp] 209 / 1e-69 AT1G18100 205 / 4e-68 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10004886 [exp] 182 / 3e-59 AT2G27550 267 / 2e-92 centroradialis (.1) Lus10027442 [exp] 178 / 2e-57 AT5G62040 248 / 4e-85 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10020600 [exp] 176 / 1e-56 AT2G27550 263 / 3e-91 centroradialis (.1) Lus10021372 [exp] 172 / 2e-55 AT5G03840 267 / 1e-92 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10005753 [exp] 171 / 2e-54 AT5G62040 241 / 5e-82 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10013532 [exp] 167 / 5e-53 AT1G65480 278 / 6e-97 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10043385 [exp] 164 / 7e-52 AT2G27550 259 / 2e-89 centroradialis (.1) Lus10004452 [exp] 167 / 1e-50 AT1G65480 270 / 1e-90 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01161 [poplar] [flax] PBP Phosphatidylethanolamine-binding protein
Representative CDS sequence Show only first row Show all	>Potri.015G041000.1 pacid=42774972 polypeptide=Potri.015G041000.1.p locus=Potri.015G041000 ID=Potri.015G041000.1.v4.1 annot-version=v4.1 ATGGCTGCCTCTGTTGATCCTCTTGTTGTTGGTCGTGTTATTGGTGATGTGGTTGATATGTTTGTCCCTGCTGTAAAAATGTCTGTTTATTATGGATCAA AGCATGTTAGCAATGGGTGTGATATTAAGCCTTCTTTGTCCGTGGACCCTCCCAAAGTGACCATTTCTGGCCACTCTGACGAGCTGTACACTCTGGTGAT GACTGATCCTGATGCACCCAGCCCTAGTGAACCCAGAATGCGAGAGTGGGTTCATTGGATCGTTGCGGACATTCCTGGGGGCACAAACCCTACTCGAGGG AAAGAGATCCTTTCCTATGTTGGGCCTCGTCCGCCGGTGGGAATTCATCGCTACATACTGGTGCTTTTCCAGCAGAAGATGCCGCTGGGGAGCATGGTGG AACCACCGCAGAACCGTTCTCATTTCAACACTCGACTCTATGCTGCTCATTTGGACCTGGGCCTGCCTGTTGCCACCGTCTACTTCAATGCTCAGAAGGA GCCAGCAAATAAGAGGCGCTAA
AA sequence Show only first row Show all	>Potri.015G041000.1 pacid=42774972 polypeptide=Potri.015G041000.1.p locus=Potri.015G041000 ID=Potri.015G041000.1.v4.1 annot-version=v4.1 MAASVDPLVVGRVIGDVVDMFVPAVKMSVYYGSKHVSNGCDIKPSLSVDPPKVTISGHSDELYTLVMTDPDAPSPSEPRMREWVHWIVADIPGGTNPTRG KEILSYVGPRPPVGIHRYILVLFQQKMPLGSMVEPPQNRSHFNTRLYAAHLDLGLPVATVYFNAQKEPANKRR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G18100		MFT, E12A11	MOTHER OF FT AND TFL1, PEBP (p...		Potri.015G041000 [exp]	0	1	E12A11.1

Compare expression of checked genes

Potri.015G041000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.