Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67060 188 / 3e-61 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G098800 [exp] 199 / 2e-65 AT1G67060 353 / 9e-125 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009161 [exp] 179 / 9e-58 AT1G67060 371 / 7e-132 unknown protein Lus10028484 [exp] 48 / 2e-07 AT1G67060 219 / 3e-73 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0126 [poplar] [flax] Peptidase_MA PF13398 [poplar] [flax] Peptidase_M50B Peptidase M50B-like
Representative CDS sequence Show only first row Show all	>Potri.015G045900.6 pacid=42774857 polypeptide=Potri.015G045900.6.p locus=Potri.015G045900 ID=Potri.015G045900.6.v4.1 annot-version=v4.1 ATGGTTTTGATACTTGCATCCACAAATCTTCTTACTGCCAGAATAGCTGCAGGATGTTTTATTGCTTCTCTACTTGTTATGCTCTTGGTAGCTAAAAATT GGACTCTTCGAGGACTTTGCATTGGATTTGTTCTTTTCCTTGGGGTGGTTTGGGTCCTGCAAGAAACAACAAAAATTCATATACTTCGGTACATCATTCT TTTCATTGGTGTCATGAACAGCCTGTTTTCAGTTTATGACATATATGATGATCTGATATCTCGTAGAGTTCATTCTAGCGATGCAGAGAAATTTGCCGAA GTATGTCCATGTCCATGTAATGGTGCCGGATGGGGATTCATATGGGGGGTGATATCTTTCTTGTTTCTTTGTGGAGCCATGTACCTTGGTCTTGTGATAT TGTCTTGA
AA sequence Show only first row Show all	>Potri.015G045900.6 pacid=42774857 polypeptide=Potri.015G045900.6.p locus=Potri.015G045900 ID=Potri.015G045900.6.v4.1 annot-version=v4.1 MVLILASTNLLTARIAAGCFIASLLVMLLVAKNWTLRGLCIGFVLFLGVVWVLQETTKIHILRYIILFIGVMNSLFSVYDIYDDLISRRVHSSDAEKFAE VCPCPCNGAGWGFIWGVISFLFLCGAMYLGLVILS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G67060			unknown protein		Potri.015G045900 [exp]	0	1
AT1G01020		ARV1	Arv1-like protein (.1.2)		Potri.014G107300 [exp]	1.73	0.7917
AT1G04420			NAD(P)-linked oxidoreductase s...		Potri.015G042100 [exp]	9.53	0.7452
AT1G19350	BZR	BZR2, BES1	BRASSINAZOLE-RESISTANT 2, BRI1...		Potri.016G125700 [exp]	31.22	0.7410
AT2G16405			Transducin/WD40 repeat-like su...		Potri.009G121100 [exp]	49.79	0.6985
AT3G49660		AtWDR5a	human WDR5 \(WD40 repeat\) hom...		Potri.015G026100 [exp]	54.22	0.7422
AT1G23030		PUB11	ARM repeat superfamily protein...		Potri.010G113900 [exp]	54.90	0.7140
AT1G55860		UPL1	ubiquitin-protein ligase 1 (.1...		Potri.007G102500 [exp]	75.72	0.7050
AT1G56590		ZIP4	ZIG SUPPRESSOR 4, Clathrin ada...		Potri.005G010600 [exp]	88.79	0.7230
					Potri.010G031250 [exp]	92.86	0.7124
AT2G23093			Major facilitator superfamily ...		Potri.007G052700 [exp]	97.54	0.6853

Compare expression of checked genes

Potri.015G045900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.