Potri.015G046600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18360 81 / 3e-18 VQ motif-containing protein (.1)
AT1G68450 58 / 1e-10 PDE337 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
AT1G21326 51 / 7e-08 VQ motif-containing protein (.1)
AT3G18690 49 / 4e-07 MKS1 MAP kinase substrate 1 (.1)
AT1G21320 49 / 1e-06 nucleotide binding;nucleic acid binding (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G055900 171 / 4e-54 AT3G18360 73 / 2e-15 VQ motif-containing protein (.1)
Potri.010G123700 81 / 1e-18 AT1G68450 64 / 9e-13 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Potri.005G189300 56 / 1e-09 AT1G21326 75 / 4e-16 VQ motif-containing protein (.1)
Potri.002G070600 56 / 2e-09 AT1G21326 76 / 3e-16 VQ motif-containing protein (.1)
Potri.005G057800 52 / 3e-08 AT3G18690 124 / 2e-35 MAP kinase substrate 1 (.1)
Potri.006G199300 48 / 2e-07 AT1G68450 60 / 1e-12 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Potri.007G110100 46 / 4e-06 AT3G18690 119 / 3e-33 MAP kinase substrate 1 (.1)
Potri.009G024200 40 / 0.0002 AT3G58000 73 / 7e-17 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009033 99 / 1e-25 AT3G18360 110 / 5e-29 VQ motif-containing protein (.1)
Lus10042794 58 / 1e-10 AT1G21326 74 / 9e-17 VQ motif-containing protein (.1)
Lus10029768 58 / 2e-10 AT1G21326 79 / 4e-18 VQ motif-containing protein (.1)
Lus10012286 48 / 9e-08 AT1G21326 50 / 8e-09 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.015G046600.1 pacid=42776231 polypeptide=Potri.015G046600.1.p locus=Potri.015G046600 ID=Potri.015G046600.1.v4.1 annot-version=v4.1
ATGAGCCCAGCAAATCTCCATGATCACAAAGCAAAGACCAAGGATATGTACCCACCACCACCCTTGAAAGTCAACAAGGACTCTCACATGATCAAAAAAT
CATTTCCATCACCGCCGTCGTCATCTTCATCCTCCGCGTCTTCGCTAGCTGTTACAGGTCCCATCAAGCCCCATCCGGTGATCATCTACACCCACTCGCC
CAAAATCATCCACACAAACCCTAAGGATTTCATGGCATTGGTGCAAAAACTAACGGGCTTATCGCAGTCCGAGGATATTGACCCGTCGGCACCTCAAGTA
AGGAAAGAAAATGGTTATAGGGTGGTGGCGAAGGAGGAAAACAAGAAGGTTAAGATTAACGATGATAATGAATCGTCTTCAGCCATTACTGATCATGAGA
ATTATGGGAGCATTGGTGATCGTGGACAATGTTTTATGCCTCGCCATCCTAATTACATGACTAATATTCCAATCTTTACACCTAATTTAGCTGAGTTTCT
ATGCGCAAACCAGCCATGCTATAATAACTATACTACGGATCCTTTATTTCTTTCCTTCTCCAAATATGATCTCACCAACTTCTGCCTTGGAGGTGAAGAC
TAG
AA sequence
>Potri.015G046600.1 pacid=42776231 polypeptide=Potri.015G046600.1.p locus=Potri.015G046600 ID=Potri.015G046600.1.v4.1 annot-version=v4.1
MSPANLHDHKAKTKDMYPPPPLKVNKDSHMIKKSFPSPPSSSSSSASSLAVTGPIKPHPVIIYTHSPKIIHTNPKDFMALVQKLTGLSQSEDIDPSAPQV
RKENGYRVVAKEENKKVKINDDNESSSAITDHENYGSIGDRGQCFMPRHPNYMTNIPIFTPNLAEFLCANQPCYNNYTTDPLFLSFSKYDLTNFCLGGED

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G18360 VQ motif-containing protein (.... Potri.015G046600 0 1
AT5G04010 F-box family protein (.1) Potri.006G044801 1.73 0.9836
AT5G41330 BTB/POZ domain with WD40/YVTN ... Potri.001G102300 2.44 0.9796
AT5G49620 MYB ATMYB78 myb domain protein 78 (.1.2) Potri.002G191800 2.82 0.9663
Potri.010G078950 3.74 0.9703
AT3G29000 Calcium-binding EF-hand family... Potri.008G087900 3.87 0.9753
AT1G80840 WRKY ATWRKY40, WRKY4... WRKY DNA-binding protein 40 (.... Potri.003G182200 4.00 0.9755 WRKY40.2
AT1G30135 ZIM TIFY5A, JAZ8 jasmonate-zim-domain protein 8... Potri.011G083900 6.63 0.9540
AT1G72450 ZIM TIFY11B, JAZ6 TIFY DOMAIN PROTEIN 11B, jasmo... Potri.003G068900 7.93 0.9597
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Potri.014G046900 8.06 0.9514 ERF11,Pt-EREBP1.3
AT1G19180 ZIM TIFY10A, JAZ1 jasmonate-zim-domain protein 1... Potri.001G166200 9.79 0.9539

Potri.015G046600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.