Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07910 341 / 3e-119 Leucine-rich repeat (LRR) family protein (.1) AT2G30105 140 / 1e-39 unknown protein AT2G17440 92 / 5e-21 PIRL5 plant intracellular ras group-related LRR 5 (.1) AT4G35470 83 / 6e-18 PIRL4, DREB1C plant intracellular ras group-related LRR 4 (.1) AT3G15410 73 / 1e-14 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT5G05850 73 / 2e-14 PIRL1 plant intracellular ras group-related LRR 1 (.1) AT1G12970 69 / 4e-13 PIRL3 plant intracellular ras group-related LRR 3 (.1) AT3G26500 64 / 2e-11 PIRL2 plant intracellular ras group-related LRR 2 (.1) AT5G63930 64 / 2e-11 Leucine-rich repeat protein kinase family protein (.1) AT5G25930 63 / 4e-11 Protein kinase family protein with leucine-rich repeat domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G280500 [exp] 144 / 8e-41 AT2G30105 503 / 1e-179 unknown protein Potri.007G065000 [exp] 102 / 2e-24 AT4G35470 693 / 0.0 plant intracellular ras group-related LRR 4 (.1) Potri.005G098600 [exp] 98 / 5e-23 AT4G35470 672 / 0.0 plant intracellular ras group-related LRR 4 (.1) Potri.003G090100 [exp] 84 / 3e-18 AT2G17440 416 / 2e-140 plant intracellular ras group-related LRR 5 (.1) Potri.001G144100 [exp] 78 / 3e-16 AT4G35470 448 / 6e-153 plant intracellular ras group-related LRR 4 (.1) Potri.010G046500 [exp] 74 / 6e-15 AT1G12970 493 / 7e-173 plant intracellular ras group-related LRR 3 (.1) Potri.012G085600 [exp] 69 / 4e-13 AT3G11330 427 / 8e-146 plant intracellular ras group-related LRR 9 (.1) Potri.015G083800 [exp] 67 / 2e-12 AT3G11330 471 / 9e-163 plant intracellular ras group-related LRR 9 (.1) Potri.011G121700 [exp] 66 / 6e-12 AT3G15410 749 / 0.0 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021635 [exp] 380 / 1e-134 AT5G07910 360 / 6e-127 Leucine-rich repeat (LRR) family protein (.1) Lus10000681 [exp] 378 / 1e-133 AT5G07910 357 / 2e-125 Leucine-rich repeat (LRR) family protein (.1) Lus10031861 [exp] 145 / 3e-41 AT2G30105 437 / 7e-154 unknown protein Lus10031291 [exp] 145 / 4e-41 AT2G30105 444 / 2e-156 unknown protein Lus10035976 [exp] 99 / 2e-23 AT4G35470 652 / 0.0 plant intracellular ras group-related LRR 4 (.1) Lus10016684 [exp] 98 / 9e-23 AT1G55325 733 / 0.0 MACCHI-BOU 2, GRAND CENTRAL, RNA polymerase II transcription mediators (.1.2) Lus10000900 [exp] 84 / 4e-18 AT4G35470 409 / 2e-138 plant intracellular ras group-related LRR 4 (.1) Lus10017948 [exp] 79 / 2e-16 AT3G11330 557 / 0.0 plant intracellular ras group-related LRR 9 (.1) Lus10013689 [exp] 78 / 3e-16 AT3G11330 473 / 3e-165 plant intracellular ras group-related LRR 9 (.1) Lus10004559 [exp] 73 / 5e-15 AT4G35470 274 / 1e-89 plant intracellular ras group-related LRR 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [poplar] [flax] LRR PF13855 [poplar] [flax] LRR_8 Leucine rich repeat
Representative CDS sequence Show only first row Show all	>Potri.015G048800.3 pacid=42776423 polypeptide=Potri.015G048800.3.p locus=Potri.015G048800 ID=Potri.015G048800.3.v4.1 annot-version=v4.1 ATGGGTTGCTGTGCAAGCCAAAACGTGGATTCTAAAGCTTCTAGGATTGCCCGCTGGCGATCTACCGGCATTGTTGCTTTTCGCGACGCTAAATTGAAGG CTTTTCCTGACGAGGTTCTTGATCTTGACAAAGCGGTCCGCACCCTTGATTTAACACACAATAAATTGGTTGACATTCCAATGGAGATCAGCAAATTGAT AAACCTGCAACGCCTGGTTTTAGCTGATAATCTTGTTGAGCGATTGCCAATGAATTTGGGGAAACTGCAGTCACTAAAAGTTATGACTCTTGATGGGAAT CGAATTGCTTCCTTACCTGATGAATTGGGTCAGCTGGTGAGGCTTGAGAGGCTTTCCATCTCAGATAACATTCTAACATGCTTGCCTGAGACGATTGGGA GTTTGCGCAATTTATCACTTTTAAATGTGTCAAATAACAAGTTAAAGACTCTTCCAGAATCAATTGGGAGTTGTTTCTCTCTAGAAGAATTACAAGCAAA TGATAATCTCATTGAAGATCTTCCTGCATCTGTTTGCAATCTCATTCACTTGAAGTCGCTTTCCCTGAACAATAATAGTGTGGGCCAGATTCCTCCAAAT CTTTTGAAAGACTGTAAGGCTCTCCAGAGTATTTCTTTGCATGATAATCCAATTTCTATGGATCAATTTCAGCAGATGGAAGGATTTCAAGAATTTGAAG GCAGAAGGAAGAGGAAGTTTGACAAACAAATAGATTCAAACGTAATGATTGGTTCAAAAGGCCTTGATGAGGGTGTTGATCTATGA
AA sequence Show only first row Show all	>Potri.015G048800.3 pacid=42776423 polypeptide=Potri.015G048800.3.p locus=Potri.015G048800 ID=Potri.015G048800.3.v4.1 annot-version=v4.1 MGCCASQNVDSKASRIARWRSTGIVAFRDAKLKAFPDEVLDLDKAVRTLDLTHNKLVDIPMEISKLINLQRLVLADNLVERLPMNLGKLQSLKVMTLDGN RIASLPDELGQLVRLERLSISDNILTCLPETIGSLRNLSLLNVSNNKLKTLPESIGSCFSLEELQANDNLIEDLPASVCNLIHLKSLSLNNNSVGQIPPN LLKDCKALQSISLHDNPISMDQFQQMEGFQEFEGRRKRKFDKQIDSNVMIGSKGLDEGVDL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G07910			Leucine-rich repeat (LRR) fami...		Potri.015G048800 [exp]	0	1
AT3G53670			unknown protein		Potri.006G082100 [exp]	1.41	0.7880
AT2G31510		ATARI7, ARI7	ARABIDOPSIS ARIADNE 7, ARIADNE...		Potri.017G032000 [exp]	2.82	0.7695
AT4G20380		LSD1	LESION SIMULATING DISEASE, LSD...		Potri.011G154800 [exp]	7.54	0.7692	LSD1.2
AT1G65910	NAC	ANAC028	NAC domain containing protein ...		Potri.014G041300 [exp]	12.16	0.7600
AT3G47090			Leucine-rich repeat protein ki...		Potri.005G030555 [exp]	12.36	0.7415
AT1G32230		ATP8, CEO1, RCD...	RADICAL-INDUCED CELL DEATH1, A...		Potri.001G137200 [exp]	12.84	0.7382	CEO1.2
AT5G63440			Protein of unknown function (D...		Potri.012G096500 [exp]	14.45	0.7292
AT4G08455			BTB/POZ domain-containing prot...		Potri.002G077000 [exp]	19.74	0.7569
					Potri.011G033200 [exp]	20.85	0.7330
AT5G67140			F-box/RNI-like superfamily pro...		Potri.005G140000 [exp]	21.16	0.7338

Compare expression of checked genes

Potri.015G048800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.