Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03350 117 / 1e-31 BSD domain-containing protein (.1) AT4G13110 93 / 1e-23 BSD domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G199100 [exp] 223 / 8e-72 AT4G13110 215 / 8e-66 BSD domain-containing protein (.1) Potri.010G028801 [exp] 172 / 1e-52 AT1G03350 211 / 1e-62 BSD domain-containing protein (.1) Potri.008G199000 [exp] 171 / 1e-52 AT4G13110 179 / 4e-53 BSD domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012761 [exp] 119 / 9e-33 AT1G03350 241 / 1e-76 BSD domain-containing protein (.1) Lus10042670 [exp] 118 / 6e-32 AT1G03350 305 / 7e-99 BSD domain-containing protein (.1) Lus10029636 [exp] 115 / 5e-31 AT1G03350 302 / 1e-97 BSD domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03909 [poplar] [flax] BSD BSD domain
Representative CDS sequence Show only first row Show all	>Potri.015G050700.1 pacid=42775697 polypeptide=Potri.015G050700.1.p locus=Potri.015G050700 ID=Potri.015G050700.1.v4.1 annot-version=v4.1 ATGGCCCAGATCATTTCTCAAGGTAAAGACTCCATGTTAGCCTCTGATCATGATCATGATCGTGATTTACTCTTATCTAATACTAATATCAATAGAAGTA GTTTGGGTAAACAGTACAGTCGTTTTGATGCTCAAGTGCGTGCATTGCAATGTGATTTCGATACTTACTGTAGTGAACCTGAGGATAAGGAGGATTATGA GAAATGGAAATCAAGGGGTTTTGTGATTGATGAGAAAAAGGAGGAGATTGAGAGGTTTATTAGTGAAAATCGGGTGATCAGGGAGATTTATGGCGAGGTT GTGCCTAATAAAGTTGATGATGAGAGTTTTTGGAGCAGGTTCTTTTGTAGGATTTTTAAGTTGAACCAAGCAGAGGAGGCAGGCAGGGCTTTGCTTGTTA AACGCTGA
AA sequence Show only first row Show all	>Potri.015G050700.1 pacid=42775697 polypeptide=Potri.015G050700.1.p locus=Potri.015G050700 ID=Potri.015G050700.1.v4.1 annot-version=v4.1 MAQIISQGKDSMLASDHDHDRDLLLSNTNINRSSLGKQYSRFDAQVRALQCDFDTYCSEPEDKEDYEKWKSRGFVIDEKKEEIERFISENRVIREIYGEV VPNKVDDESFWSRFFCRIFKLNQAEEAGRALLVKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G03350			BSD domain-containing protein ...		Potri.015G050700 [exp]	0	1
AT5G51410			LUC7 N_terminus domain-contain...		Potri.001G124300 [exp]	4.24	0.8066
AT1G53300		TTL1	tetratricopetide-repeat thiore...		Potri.001G392601 [exp]	5.65	0.8038
AT1G15280			CASC3/Barentsz eIF4AIII bindin...		Potri.003G056500 [exp]	6.92	0.8129
AT1G21200	Trihelix		sequence-specific DNA binding ...		Potri.003G204700 [exp]	8.94	0.7632
AT3G54630			unknown protein		Potri.001G208700 [exp]	9.16	0.7851
AT5G47680		AtTRM, TRM10	tRNA modification 10, unknown ...		Potri.016G005500 [exp]	12.24	0.8220
AT5G49880			mitotic checkpoint family prot...		Potri.003G000900 [exp]	13.60	0.7643
AT3G28730		NFD, SSRP1, ATH...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Potri.004G124000 [exp]	16.88	0.7463	ATHMG.2
AT4G19900			alpha 1,4-glycosyltransferase ...		Potri.015G122200 [exp]	20.78	0.7557
AT1G70750			Protein of unknown function, D...		Potri.010G109900 [exp]	22.44	0.7650

Compare expression of checked genes

Potri.015G050700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.