Potri.015G051101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G43760 83 / 6e-19 DNAse I-like superfamily protein (.1)
AT1G40390 41 / 0.0002 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G064001 344 / 1e-122 AT1G43760 85 / 4e-19 DNAse I-like superfamily protein (.1)
Potri.003G047051 340 / 7e-121 AT1G43760 99 / 7e-24 DNAse I-like superfamily protein (.1)
Potri.003G047001 340 / 9e-118 AT1G43760 265 / 5e-82 DNAse I-like superfamily protein (.1)
Potri.019G047975 334 / 5e-116 AT1G43760 157 / 3e-42 DNAse I-like superfamily protein (.1)
Potri.005G151275 335 / 3e-114 AT1G43760 268 / 1e-81 DNAse I-like superfamily protein (.1)
Potri.012G063901 333 / 3e-113 AT1G43760 266 / 1e-80 DNAse I-like superfamily protein (.1)
Potri.017G066550 310 / 3e-110 AT1G43760 72 / 3e-15 DNAse I-like superfamily protein (.1)
Potri.004G128840 310 / 1e-109 AT1G43760 87 / 5e-20 DNAse I-like superfamily protein (.1)
Potri.004G128941 309 / 3e-106 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.015G051101.1 pacid=42775856 polypeptide=Potri.015G051101.1.p locus=Potri.015G051101 ID=Potri.015G051101.1.v4.1 annot-version=v4.1
ATGTGGATGGATCATGACGAGTTCATGCCCTTGGTGAAGAAGGTATGGGATCAGAATTCGGGGGGTTGTCCAATGTATCAGCTGTGTTGCAAACTAAGAA
AGCTAAAGCAGGAATTGAAACTTTTCAATATGGCTCACTTCTCCAACATTTCAGATAGAGTTAAAGATGCAAAAAACGAAATGGATAAGGTTCAACAGGC
TCTGCATACAGCGCATGAGAATCCAATTTTGTGCATGCGAGAAAGGGATGCTGTTCATAAATACGCTTCTACCGTCAGGGCTGAAGAGAGTTTTTTCAAA
CAGAAGGCAAGGATACAATGGCTTAGCTTGGGGGATCAGAATACTAGCTACTTTCACAAATCAGTAAATGGAAGACAGAATAGAAATAAGCTTCTATCAC
TTACAACGGAGGATGGAGAGGTTGTCGAAGGACACGAGGCAGTCAAATCAGAAGTAATTGCATACTTCCATCGTGTGTTAGGAGTGGATCAGAAATAA
AA sequence
>Potri.015G051101.1 pacid=42775856 polypeptide=Potri.015G051101.1.p locus=Potri.015G051101 ID=Potri.015G051101.1.v4.1 annot-version=v4.1
MWMDHDEFMPLVKKVWDQNSGGCPMYQLCCKLRKLKQELKLFNMAHFSNISDRVKDAKNEMDKVQQALHTAHENPILCMRERDAVHKYASTVRAEESFFK
QKARIQWLSLGDQNTSYFHKSVNGRQNRNKLLSLTTEDGEVVEGHEAVKSEVIAYFHRVLGVDQK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G43760 DNAse I-like superfamily prote... Potri.015G051101 0 1
AT1G43760 DNAse I-like superfamily prote... Potri.003G047051 2.82 0.6690
AT5G19820 EMB2734 embryo defective 2734, ARM rep... Potri.007G084100 6.63 0.7191
Potri.015G074450 6.70 0.6879
AT5G05800 unknown protein Potri.010G132850 9.16 0.6709
AT5G66350 SHI SHORT INTERNODES, Lateral root... Potri.009G121600 21.63 0.6790
AT3G08720 ATPK2, ATPK19, ... ARABIDOPSIS THALIANA SERINE/TH... Potri.019G061800 24.14 0.6582
AT1G53050 Protein kinase superfamily pro... Potri.005G086900 27.92 0.5938
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Potri.019G016400 29.08 0.5899
AT3G63230 Protein of unknown function (D... Potri.002G050100 30.19 0.5765
Potri.007G048201 34.58 0.5765

Potri.015G051101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.