Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68585 57 / 1e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G119300 [exp] 63 / 6e-14 AT1G68585 97 / 3e-27 unknown protein Potri.010G126800 [exp] 62 / 1e-13 AT1G68585 92 / 3e-25 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035025 [exp] 59 / 3e-12 AT1G68585 84 / 9e-22 unknown protein Lus10021686 [exp] 59 / 4e-12 AT1G68585 92 / 5e-25 unknown protein Lus10032489 [exp] 54 / 4e-10 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.015G053600.2 pacid=42775413 polypeptide=Potri.015G053600.2.p locus=Potri.015G053600 ID=Potri.015G053600.2.v4.1 annot-version=v4.1 ATGGAATTTTGGGCTGAGAAGGGGCTTGCTAAACTTACAATCTACAAACATGTAAGACCACCGCTTCGTCGAATCATCTCAGCTCCTGTTATCTCCTCGC AGAAACCTCTGGTTCAGGAAGTTGTTTTAGCAGCCGAATTGCGATGCCCCAGCTGCCAAAAGAGGGTGAATGATGCAATTTCAAGTATTGAAGATTTGGA ATCTATTGTGGTGCATGTGGTAGAAAAGAAAGTGACACTCACTCCTAAATCTGTCGCTGAAGGTTCTTCGACAAGAGTCCCTGCTGTCTTCAACAACCTA GCCTACAAAACGTTAAGGAATCCTCTACTTTCTTACCACGTATAG
AA sequence Show only first row Show all	>Potri.015G053600.2 pacid=42775413 polypeptide=Potri.015G053600.2.p locus=Potri.015G053600 ID=Potri.015G053600.2.v4.1 annot-version=v4.1 MEFWAEKGLAKLTIYKHVRPPLRRIISAPVISSQKPLVQEVVLAAELRCPSCQKRVNDAISSIEDLESIVVHVVEKKVTLTPKSVAEGSSTRVPAVFNNL AYKTLRNPLLSYHV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68585			unknown protein		Potri.015G053600 [exp]	0	1
AT2G20362			unknown protein		Potri.002G256100 [exp]	3.46	0.8599
AT5G27690			Heavy metal transport/detoxifi...		Potri.002G206900 [exp]	6.92	0.8430
AT4G02260		AT-RSH1, RSH1, ...	RELA-SPOT HOMOLOG 1, RELA/SPOT...		Potri.001G434400 [exp]	15.42	0.7176
AT1G05610		APS2	ADP-glucose pyrophosphorylase ...		Potri.017G001700 [exp]	16.15	0.7090
AT5G46530			AWPM-19-like family protein (....		Potri.011G077800 [exp]	17.83	0.7975
AT5G45540			Protein of unknown function (D...		Potri.003G064200 [exp]	26.45	0.8127
AT5G42146			unknown protein		Potri.009G129301 [exp]	44.49	0.7342
AT4G21320		HSA32	HEAT-STRESS-ASSOCIATED 32, Ald...		Potri.011G031600 [exp]	52.24	0.7465
AT1G36940			unknown protein		Potri.005G171600 [exp]	53.66	0.7168
AT3G24110			Calcium-binding EF-hand family...		Potri.001G314900 [exp]	54.89	0.6192

Compare expression of checked genes

Potri.015G053600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.