Plant FIBer expression Database

Potri.015G058500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08040 86 / 2e-24 TOM5 mitochondrial import receptor subunit TOM5 homolog (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034683
[exp]
45 / 4e-08 AT5G08040 45 / 6e-08 mitochondrial import receptor subunit TOM5 homolog (.1)
PFAM info
Representative CDS sequence
>Potri.015G058500.1 pacid=42776503 polypeptide=Potri.015G058500.1.p locus=Potri.015G058500 ID=Potri.015G058500.1.v4.1 annot-version=v4.1
ATGGCAGATTCATCAGTTTCTATTGACCAGCTAAAAGCTATCTGGCACTCTCAAGTTCACGATGAGGAAAAATGGGCCCTCAACATGAAACTGCTGCGAG
CTGTTGGGCTGTTTGCTGGATCTATTTTTCTGATGCGGAATTATGGTGATCTTATGGCAATATGA
AA sequence
>Potri.015G058500.1 pacid=42776503 polypeptide=Potri.015G058500.1.p locus=Potri.015G058500 ID=Potri.015G058500.1.v4.1 annot-version=v4.1
MADSSVSIDQLKAIWHSQVHDEEKWALNMKLLRAVGLFAGSIFLMRNYGDLMAI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G08040 TOM5 mitochondrial import receptor ... Potri.015G058500
[exp]
0 1
AT3G01130 unknown protein Potri.009G125832
[exp]
1.00 0.8778
AT3G07568 unknown protein Potri.014G197400
[exp]
1.41 0.8022
AT1G79070 SNARE-associated protein-relat... Potri.011G144400
[exp]
2.44 0.7288
AT1G32400 TOM2A tobamovirus multiplication 2A ... Potri.001G146100
[exp]
2.82 0.7396 Pt-TOM2.2
Potri.012G127000
[exp]
3.87 0.7501
AT5G14240 Thioredoxin superfamily protei... Potri.017G066200
[exp]
7.74 0.7365
AT1G62350 Pentatricopeptide repeat (PPR)... Potri.001G275000
[exp]
10.67 0.6882
AT1G04960 Protein of unknown function (D... Potri.002G219300
[exp]
12.84 0.7029
AT4G10265 Wound-responsive family protei... Potri.019G117800
[exp]
27.16 0.7086
AT1G10180 unknown protein Potri.012G120000
[exp]
31.84 0.6190

Potri.015G058500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.