Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G17390 197 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G03720 170 / 8e-54 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G69080 158 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G44760 98 / 4e-25 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT4G13450 79 / 1e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G48960 55 / 4e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G140200 [exp] 212 / 3e-69 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.008G109000 [exp] 209 / 4e-68 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.T170801 [exp] 208 / 1e-67 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G064800 [exp] 95 / 7e-24 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.002G084600 [exp] 95 / 1e-23 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G177100 [exp] 94 / 1e-23 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 52 / 2e-08 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 48 / 7e-07 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 47 / 1e-06 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019173 [exp] 197 / 2e-63 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10034661 [exp] 196 / 7e-63 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007982 [exp] 182 / 7e-57 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10036814 [exp] 121 / 1e-35 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10025644 [exp] 89 / 7e-22 AT1G44760 211 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10042701 [exp] 83 / 3e-19 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10018190 [exp] 82 / 3e-19 AT1G44760 197 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10014459 [exp] 82 / 5e-19 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10029664 [exp] 82 / 7e-19 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10023716 [exp] 61 / 1e-11 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.015G060700.3 pacid=42776005 polypeptide=Potri.015G060700.3.p locus=Potri.015G060700 ID=Potri.015G060700.3.v4.1 annot-version=v4.1 ATGGCTCCGTCACGTCGGAGACTAACAAAGTTTAGTGTTGGTCGATCCATAGCTCGTGTTGGGATCCGTTCTCCCTCCCATCGGTCCAAACCCACCTCTA GTTCCAGTGAAGGTGATTCAAAAATGGAGTTTTTGGGCAGTGGCAAGGAGAGTTTTTGTGGCGATGGTTTTGGAAATGGCAACAAGGTTATGGTGGTAGT CGATACAAGCCGTGAAGCCATGGGTGCTCTTGAATGGGCGTTGTCTCACACGGTTCAGAACCAAGATACCATTGTTCTTCTTTATGTCTCTAAGCCATCC AAACAAGGCCCTGAATCTAGTTTGAAGCTTAATCTGAGGGCTCATGAGACGCTTCACTCCATGAAAAATATGTGTCAAAGGAGAAGGCCAGGGGTGCAGG TGGCGGTGGCGGTGCATGAGGGTAAAGAAAGGGGTCCCATAATAGTGGAAGAAGCAAAACAACGAAGCGTATCACTGCTTGTGATGGGGCAAAGAAAACG ATCGATAATGTGGCGCCTTATTGAGAGATGGGCAGGGAAGGGGAACCGCGGTGGCTCTGGGGCGGTGGGGTATTGCATCCAAAATGCTTCCTGCATGACA ATTGCAGTGAGGAGGAAGGGCAAAAAACTTGGAGGTTATTTGATCACCACCAAGCGTCATAAAAACTTTTGGCTTTTGGCTTAG
AA sequence Show only first row Show all	>Potri.015G060700.3 pacid=42776005 polypeptide=Potri.015G060700.3.p locus=Potri.015G060700 ID=Potri.015G060700.3.v4.1 annot-version=v4.1 MAPSRRRLTKFSVGRSIARVGIRSPSHRSKPTSSSSEGDSKMEFLGSGKESFCGDGFGNGNKVMVVVDTSREAMGALEWALSHTVQNQDTIVLLYVSKPS KQGPESSLKLNLRAHETLHSMKNMCQRRRPGVQVAVAVHEGKERGPIIVEEAKQRSVSLLVMGQRKRSIMWRLIERWAGKGNRGGSGAVGYCIQNASCMT IAVRRKGKKLGGYLITTKRHKNFWLLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G03290			Adenine nucleotide alpha hydro...		Potri.015G060700 [exp]	0	1
AT1G52855			unknown protein		Potri.013G145100 [exp]	4.00	0.8785
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Potri.005G236102 [exp]	5.29	0.8577
					Potri.019G071050 [exp]	6.92	0.8082
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Potri.019G071200 [exp]	13.63	0.7126	CYP749A2
AT1G69120	MADS	AGL7, AP1	APETALA1, AGAMOUS-like 7, K-bo...		Potri.008G098500 [exp]	21.90	0.7117	PtrAP1-1,AGL8.1
					Potri.003G015433 [exp]	30.19	0.7272
AT2G42560			late embryogenesis abundant do...		Potri.013G118600 [exp]	30.98	0.7440
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Potri.011G076500 [exp]	31.49	0.7354
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Potri.018G036700 [exp]	35.35	0.8402
AT5G15720		GLIP7	GDSL-motif lipase 7 (.1)		Potri.004G112700 [exp]	35.70	0.7212

Compare expression of checked genes

Potri.015G060700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.