Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62740 311 / 6e-108 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) AT1G69840 289 / 5e-99 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7) AT3G01290 270 / 2e-91 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) AT5G51570 189 / 1e-59 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G070500 [exp] 332 / 5e-116 AT5G62740 484 / 3e-175 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.017G078100 [exp] 318 / 3e-110 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.017G078000 [exp] 287 / 2e-98 AT5G62740 518 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.012G129000 [exp] 193 / 3e-61 AT5G51570 480 / 4e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.015G130600 [exp] 187 / 4e-59 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033099 [exp] 316 / 2e-109 AT5G62740 533 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10004268 [exp] 307 / 3e-106 AT5G62740 535 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10007268 [exp] 298 / 2e-102 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10015356 [exp] 295 / 4e-101 AT5G62740 506 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10037213 [exp] 287 / 3e-98 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7) Lus10036715 [exp] 284 / 7e-97 AT1G69840 516 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7) Lus10015032 [exp] 188 / 3e-59 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10038907 [exp] 184 / 1e-57 AT5G51570 529 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.015G065001.1 pacid=42775299 polypeptide=Potri.015G065001.1.p locus=Potri.015G065001 ID=Potri.015G065001.1.v4.1 annot-version=v4.1 ATGGGTAATCTGTTTTGTTGCGTACAAGTTGATCAGTCCACATTTGAGGAAGAACTTGATGCTGGATGTCATTGCCTTCCTTGGTTTCTTGGCAGCCAGC TCGCTGGCCATCTGTCGACTCTGAGGTTGCAGCAGATGGGTGTTCGTTGTGAGACCAAGAAGGACAATGTTTTCGTAAATATTGCTTCTATTCAATACCG TGCCCTGGCAGACAAGGTAAGTGATGCTTTCTACAAGCTCAGCAACTCAAATCCAGGCCGATGCTATGTCTGCTATGGATACGTGATTGTGCAAACGCTC ATTGTTGATATAGAACCAGATGAGCATGTGAAGAGGGCAATGAATGAGATCAATGCAGAGCTGGGGCCTGGGGGTGAGGCAGAAGCAAAGTATCTCTCTG GACTGGGTATTGCTCGCCAGCGACAAGCTATTGTGGATGGCTTGAGAGAGAGTGTGTTGGGCTTCTCTGAGAATATGCCAGGGACCACTGCAAAGGATGT CATGGACATGGTCCTGGTCACCCAGTACTTCGACACAATGAAGAAAATTGGTGCTGCCTCTAAATCCTCTGCTATTTTTTTTCCTCATGGACCTGGTGAT ATCCGTGATGTTGCTACCCAGATTCAAGATGGTCTTCTTCAGGCTTCATCCCACCAGTAA
AA sequence Show only first row Show all	>Potri.015G065001.1 pacid=42775299 polypeptide=Potri.015G065001.1.p locus=Potri.015G065001 ID=Potri.015G065001.1.v4.1 annot-version=v4.1 MGNLFCCVQVDQSTFEEELDAGCHCLPWFLGSQLAGHLSTLRLQQMGVRCETKKDNVFVNIASIQYRALADKVSDAFYKLSNSNPGRCYVCYGYVIVQTL IVDIEPDEHVKRAMNEINAELGPGGEAEAKYLSGLGIARQRQAIVDGLRESVLGFSENMPGTTAKDVMDMVLVTQYFDTMKKIGAASKSSAIFFPHGPGD IRDVATQIQDGLLQASSHQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G62740		AtHIR4, ATHIR1	hypersensitive induced reactio...		Potri.015G065001 [exp]	0	1
AT2G45260			Plant protein of unknown funct...		Potri.014G067600 [exp]	5.65	0.9351
AT5G42920		AtTHO5	THO complex, subunit 5 (.1.2)		Potri.002G125300 [exp]	7.41	0.9310
AT4G19610			nucleotide binding;nucleic aci...		Potri.001G081000 [exp]	8.48	0.9156
AT3G04830			Protein prenylyltransferase su...		Potri.013G038501 [exp]	9.48	0.9208
AT5G13160		PBS1	avrPphB susceptible 1, Protein...		Potri.008G224084 [exp]	10.09	0.8894
					Potri.006G062150 [exp]	10.24	0.9242
AT2G37980			O-fucosyltransferase family pr...		Potri.006G095300 [exp]	11.95	0.9136
AT1G72770		HAB1	HYPERSENSITIVE TO ABA1, homolo...		Potri.001G198400 [exp]	12.48	0.8723
AT4G19110			Protein kinase superfamily pro...		Potri.003G190200 [exp]	13.63	0.8928
AT5G04420			Galactose oxidase/kelch repeat...		Potri.008G030901 [exp]	14.45	0.9157

Compare expression of checked genes

Potri.015G065001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.