Potri.015G068500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17770 103 / 1e-28 CBR1, ATCBR NADH:cytochrome B5 reductase 1 (.1)
AT1G37130 47 / 3e-07 NIA2-1, CHL3, B29, NR2, NIA2, ATNR2 CHLORATE RESISTANT 3, ARABIDOPSIS NITRATE REDUCTASE 2, nitrate reductase 2 (.1)
AT1G77760 45 / 1e-06 GNR1, NIA1 nitrate reductase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G067300 137 / 9e-42 AT5G17770 461 / 6e-166 NADH:cytochrome B5 reductase 1 (.1)
Potri.009G157000 102 / 5e-28 AT5G17770 421 / 3e-150 NADH:cytochrome B5 reductase 1 (.1)
Potri.004G194400 100 / 6e-27 AT5G17770 428 / 4e-153 NADH:cytochrome B5 reductase 1 (.1)
Potri.010G246800 84 / 4e-21 AT5G17770 379 / 1e-133 NADH:cytochrome B5 reductase 1 (.1)
Potri.007G072750 76 / 1e-19 AT5G17770 39 / 5e-05 NADH:cytochrome B5 reductase 1 (.1)
Potri.002G088600 49 / 6e-08 AT1G77760 1394 / 0.0 nitrate reductase 1 (.1)
Potri.005G172400 46 / 6e-07 AT1G37130 1400 / 0.0 CHLORATE RESISTANT 3, ARABIDOPSIS NITRATE REDUCTASE 2, nitrate reductase 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020310 126 / 2e-37 AT5G17770 474 / 5e-171 NADH:cytochrome B5 reductase 1 (.1)
Lus10005682 120 / 7e-35 AT5G17770 474 / 6e-171 NADH:cytochrome B5 reductase 1 (.1)
Lus10026774 91 / 2e-23 AT5G17770 425 / 1e-151 NADH:cytochrome B5 reductase 1 (.1)
Lus10008407 85 / 5e-21 AT5G17770 427 / 4e-152 NADH:cytochrome B5 reductase 1 (.1)
Lus10033405 77 / 5e-18 AT5G17770 359 / 2e-125 NADH:cytochrome B5 reductase 1 (.1)
Lus10034869 47 / 3e-07 AT5G17770 280 / 3e-94 NADH:cytochrome B5 reductase 1 (.1)
Lus10035402 44 / 3e-06 AT1G77760 1277 / 0.0 nitrate reductase 1 (.1)
Lus10038977 42 / 1e-05 AT1G77760 1397 / 0.0 nitrate reductase 1 (.1)
Lus10027270 42 / 2e-05 AT1G77760 1380 / 0.0 nitrate reductase 1 (.1)
Lus10031005 40 / 7e-05 AT1G77760 559 / 0.0 nitrate reductase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0076 FAD_Lum_binding PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Representative CDS sequence
>Potri.015G068500.1 pacid=42775324 polypeptide=Potri.015G068500.1.p locus=Potri.015G068500 ID=Potri.015G068500.1.v4.1 annot-version=v4.1
ATGGATTTAGAATTCTTGCACACTCTTGATGTTCAGATTCTTGGGGCTGTAGCTGTGGCTATTGTGGCCATTGTTATTGGTGCTGTCTTTCTCTTCTCCT
ACAAAAAGCCCAAAGGCTGCTTAGATCCAGAAAATTTCAAGCAGTTTAAACTTGTCAAGCGTGTTCAGTTGAGCCACAATGTGGCAAAGTTCACATTTGC
ACTTCCTACACCTACTTCTGTTTTAGGCCTTCCCATTGGACAACATATAAGTTGCAAGTTCAGTTCTTTCCTTCTCTTTTTGTGA
AA sequence
>Potri.015G068500.1 pacid=42775324 polypeptide=Potri.015G068500.1.p locus=Potri.015G068500 ID=Potri.015G068500.1.v4.1 annot-version=v4.1
MDLEFLHTLDVQILGAVAVAIVAIVIGAVFLFSYKKPKGCLDPENFKQFKLVKRVQLSHNVAKFTFALPTPTSVLGLPIGQHISCKFSSFLLFL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Potri.015G068500 0 1
AT3G18420 Protein prenylyltransferase su... Potri.008G142980 4.58 0.9319
AT1G12000 Phosphofructokinase family pro... Potri.011G015600 6.08 0.9448
AT3G44150 unknown protein Potri.016G068000 6.16 0.9445
AT2G30050 transducin family protein / WD... Potri.008G141300 7.54 0.9417
AT5G15490 UGD3 UDP-glucose dehydrogenase 3, U... Potri.004G118600 10.39 0.9352
AT5G60490 FLA12 FASCICLIN-like arabinogalactan... Potri.015G129400 16.24 0.9301 Pt-FLA14.7
AT2G28315 Nucleotide/sugar transporter f... Potri.004G211900 16.43 0.9324
AT5G37310 Endomembrane protein 70 protei... Potri.004G075450 18.43 0.9329
AT1G14020 O-fucosyltransferase family pr... Potri.008G090600 19.89 0.9279
AT3G54120 Reticulon family protein (.1) Potri.016G110200 20.17 0.9269

Potri.015G068500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.