Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30050 526 / 0 transducin family protein / WD-40 repeat family protein (.1) AT3G01340 520 / 0 Transducin/WD40 repeat-like superfamily protein (.1.2) AT2G26060 70 / 2e-13 EMB1345 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) AT4G02730 65 / 7e-12 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1) AT1G64350 62 / 1e-10 SEH1H Transducin/WD40 repeat-like superfamily protein (.1) AT2G43770 61 / 2e-10 Transducin/WD40 repeat-like superfamily protein (.1) AT1G11160 53 / 1e-07 Transducin/WD40 repeat-like superfamily protein (.1) AT3G49660 52 / 1e-07 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) AT4G32990 52 / 2e-07 Transducin/WD40 repeat-like superfamily protein (.1) AT3G42660 51 / 5e-07 transducin family protein / WD-40 repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G100400 [exp] 596 / 0 AT2G30050 517 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Potri.008G141300 [exp] 542 / 0 AT2G30050 465 / 2e-167 transducin family protein / WD-40 repeat family protein (.1) Potri.001G221000 [exp] 77 / 1e-15 AT2G26060 523 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.003G138300 [exp] 74 / 1e-14 AT1G64350 457 / 4e-163 Transducin/WD40 repeat-like superfamily protein (.1) Potri.002G212800 [exp] 72 / 5e-14 AT2G26060 530 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.019G096900 [exp] 60 / 5e-10 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.002G051900 [exp] 58 / 2e-09 AT4G02730 524 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1) Potri.004G184900 [exp] 57 / 7e-09 AT3G44530 1365 / 0.0 homolog of histone chaperone HIRA (.1.2) Potri.014G194100 [exp] 57 / 8e-09 AT5G43920 697 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011429 [exp] 564 / 0 AT2G30050 525 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Lus10037571 [exp] 562 / 0 AT2G30050 523 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Lus10001904 [exp] 79 / 1e-16 AT1G64350 442 / 3e-157 Transducin/WD40 repeat-like superfamily protein (.1) Lus10003896 [exp] 76 / 2e-15 AT1G64350 434 / 4e-154 Transducin/WD40 repeat-like superfamily protein (.1) Lus10021365 [exp] 68 / 9e-13 AT2G26060 482 / 2e-172 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10017045 [exp] 63 / 5e-11 AT2G26060 486 / 5e-174 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10018458 [exp] 57 / 8e-09 AT1G11160 668 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10011224 [exp] 57 / 8e-09 AT1G11160 665 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10042333 [exp] 56 / 9e-09 AT3G18140 572 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10002860 [exp] 55 / 3e-08 AT2G43770 617 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF00400 [poplar] [flax] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Potri.015G068900.2 pacid=42776679 polypeptide=Potri.015G068900.2.p locus=Potri.015G068900 ID=Potri.015G068900.2.v4.1 annot-version=v4.1 ATGCCTTCTCAAAAAATTGAAACTGGTCATGAGGACACTGTCCATGATGTGGCAATGGATTACTATGGAAAGCGGATTGCAACTGCCTCATCGGATCATT CAATCAAAATAATTGGGGTTAACAACAATACTTCTCAACATCTTGCAAATCTGACCGGGCACCAAGGCCCAGTTTGGCAAGTAGCATGGGCTCACCCGAA ATTTGGTTCTTTACTTGCTTCTTGCTCTTATGATGGCCGAGTCATAATATGGAAGGAGGGTAATCAGAATGACTGGACCCAGGCTCATGTTTTTGAGGAT CACAAATCATCTGTCAATTCCATTGCTTGGGCACCTCATGAACTGGGGCTTTCTTTGGCATGTGGTTCATCTGATGGGAATATTTCTGTTTTTACTGCTC GTGCTGATGGCAACTGGGACACATCAAGGATTGATCAAGCTCACCCGGTTGGTGTAACCTCTGTTTCATGGGCTCCATCCACTGCACCTGGTGCCCTTGT TGGTTCTGGTTTGCTTGACCCTGTGCAGAAGCTTTGTTCAGGTGGCTGTGATAATACTGTCAAAGTGTGGAAACTTTACAACGGGAACTGGAAGCTGGAC TGTTTTCCAGCTCTCAACATGCATACTGATTGGGTGAGGGATGTTGCTTGGGCACCCAACTTGGGCCTTCCCAAATCTACCATTGCTAGTGTCTCACAGG ATGGGAAGGTTATTATATGGACTGTGGCGAAGGAAGGTGATCAATGGGAAGGTAAGGTTTTACATGACTTCAAGGCTCCTGTCTGGAGGGTCTCCTGGTC CCTAACTGGAAACATACTGGCTGTTGCTGATGGGAACAACAATGTCACGTTGTGGAAAGAAGCTGTAGATGGGGAATGGCAACAGGTGACAACTGTTGAT GCCTAG
AA sequence Show only first row Show all	>Potri.015G068900.2 pacid=42776679 polypeptide=Potri.015G068900.2.p locus=Potri.015G068900 ID=Potri.015G068900.2.v4.1 annot-version=v4.1 MPSQKIETGHEDTVHDVAMDYYGKRIATASSDHSIKIIGVNNNTSQHLANLTGHQGPVWQVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWTQAHVFED HKSSVNSIAWAPHELGLSLACGSSDGNISVFTARADGNWDTSRIDQAHPVGVTSVSWAPSTAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGNWKLD CFPALNMHTDWVRDVAWAPNLGLPKSTIASVSQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGNNNVTLWKEAVDGEWQQVTTVD A

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30050			transducin family protein / WD...		Potri.015G068900 [exp]	0	1
AT2G30050			transducin family protein / WD...		Potri.010G100400 [exp]	1.41	0.7305
AT5G07960			unknown protein		Potri.012G065500 [exp]	4.24	0.7294
AT1G72430			SAUR-like auxin-responsive pro...		Potri.001G164300 [exp]	4.47	0.6393
AT5G58290		RPT3	regulatory particle triple-A A...		Potri.016G028000 [exp]	11.31	0.6545	RPT1.2
AT5G05987		PRA1.A2	prenylated RAB acceptor 1.A2 (...		Potri.010G198000 [exp]	15.00	0.6413
AT1G06110		SKIP16	SKP1/ASK-interacting protein 1...		Potri.017G027000 [exp]	16.88	0.6473
AT5G09310			unknown protein		Potri.005G063100 [exp]	18.70	0.6459
AT2G43790		ATMAPK6, MAPK6,...	MAP kinase 6 (.1)		Potri.007G139800 [exp]	19.13	0.6470	Pt-MPK6.1
AT2G32580			Protein of unknown function (D...		Potri.002G227100 [exp]	24.08	0.5956
AT5G08060			unknown protein		Potri.004G123700 [exp]	24.71	0.6340

Compare expression of checked genes

Potri.015G068900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.