Potri.015G069301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G43760 72 / 6e-15 DNAse I-like superfamily protein (.1)
AT1G40390 64 / 3e-12 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G186236 200 / 2e-65 AT1G40390 86 / 2e-19 DNAse I-like superfamily protein (.1)
Potri.014G186733 177 / 4e-56 AT1G40390 70 / 1e-13 DNAse I-like superfamily protein (.1)
Potri.003G066101 159 / 5e-50 AT1G40390 62 / 1e-11 DNAse I-like superfamily protein (.1)
Potri.019G043150 153 / 1e-47 AT1G40390 58 / 3e-10 DNAse I-like superfamily protein (.1)
Potri.009G000601 92 / 2e-23 AT1G43760 109 / 9e-28 DNAse I-like superfamily protein (.1)
Potri.012G063901 96 / 3e-23 AT1G43760 266 / 1e-80 DNAse I-like superfamily protein (.1)
Potri.004G128901 94 / 7e-23 AT1G43760 149 / 3e-39 DNAse I-like superfamily protein (.1)
Potri.004G128941 94 / 7e-23 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128961 94 / 7e-23 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.015G069301.1 pacid=42775678 polypeptide=Potri.015G069301.1.p locus=Potri.015G069301 ID=Potri.015G069301.1.v4.1 annot-version=v4.1
ATGCTTCTTGGTGATTTCAAGTCTATTCTCTCCCAAGATGATAAGCATAATGGGGATCTAATCTCTAACTATGAAACTTCAGATTTCAGGGAGTTTTGTT
CTGATCTTGGGCTGGTTGACTTGAACTCTACGGGTTGTTATTTTACATGGACAAATGGCACAGTCTGGACAAAAATTGATAGGGTTATGGTAAACATTCA
TTGGTTCTCATTGCAGCAAATGACTCATGTTCACTTTGGTACCTCAAGAGCTTTCTCAGACCATTCTCCAGCTACTGTCCAGTTGGGGATTTGGGAATTT
CATGGTAAACAGAATTTTAAATTCTACAACATGTGGGCTACTCATCCTCAGTTCTTGGAAATCATCTCCCAGCATTGGTCTTTGGATATATATGGGACGC
ATATATATATTCTCTGCAATAAGCTCAAGCAGTTGAATGGAGCCCTGAAGTCTCTGAACAATCTTCATTTCAGCCACATTTCGAAGAGGGTTGCTAGAGC
AGAAAAGACTTGGATGATACTCAGCTTCTTCTATAGAATGACAGGGATAATGGTCATCTCCTAA
AA sequence
>Potri.015G069301.1 pacid=42775678 polypeptide=Potri.015G069301.1.p locus=Potri.015G069301 ID=Potri.015G069301.1.v4.1 annot-version=v4.1
MLLGDFKSILSQDDKHNGDLISNYETSDFREFCSDLGLVDLNSTGCYFTWTNGTVWTKIDRVMVNIHWFSLQQMTHVHFGTSRAFSDHSPATVQLGIWEF
HGKQNFKFYNMWATHPQFLEIISQHWSLDIYGTHIYILCNKLKQLNGALKSLNNLHFSHISKRVARAEKTWMILSFFYRMTGIMVIS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G43760 DNAse I-like superfamily prote... Potri.015G069301 0 1
AT1G16360 LEM3 (ligand-effect modulator ... Potri.001G337466 16.00 0.7503
AT5G55590 QRT1 QUARTET 1, Pectin lyase-like s... Potri.001G365700 17.29 0.7707
AT3G06240 F-box family protein (.1) Potri.008G199601 18.57 0.5527
Potri.011G165750 19.36 0.7508
Potri.001G165120 24.45 0.7077
Potri.002G131650 25.41 0.7450
AT5G28780 PIF1 helicase (.1) Potri.001G165240 30.41 0.6978
AT2G01050 zinc ion binding;nucleic acid ... Potri.003G047101 30.59 0.6928
AT3G28480 Oxoglutarate/iron-dependent ox... Potri.017G075300 32.86 0.6374
AT4G18425 Protein of unknown function (D... Potri.017G016300 34.01 0.5235

Potri.015G069301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.