Potri.015G071500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14920 89 / 1e-22 Gibberellin-regulated family protein (.1.2)
AT2G18420 82 / 6e-22 Gibberellin-regulated family protein (.1)
AT4G09600 82 / 2e-21 GASA3 GAST1 protein homolog 3 (.1)
AT1G75750 79 / 1e-20 GASA1 GAST1 protein homolog 1 (.1.2)
AT1G22690 79 / 3e-20 Gibberellin-regulated family protein (.1.2.3)
AT4G09610 62 / 7e-14 GASA2 GAST1 protein homolog 2 (.1)
AT1G74670 58 / 4e-12 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT2G39540 54 / 1e-10 Gibberellin-regulated family protein (.1)
AT1G10588 52 / 6e-10 Gibberellin-regulated family protein (.1.2)
AT5G59845 51 / 1e-09 Gibberellin-regulated family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G076700 203 / 1e-69 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.002G022500 94 / 4e-26 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.001G350600 95 / 3e-25 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
Potri.002G022600 88 / 6e-24 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
Potri.005G239100 87 / 1e-23 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2)
Potri.005G239000 86 / 3e-23 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Potri.002G022700 83 / 4e-22 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Potri.019G083900 82 / 2e-21 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.013G113400 76 / 2e-19 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039443 95 / 8e-26 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2)
Lus10034524 91 / 9e-25 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10017212 87 / 1e-23 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10033145 79 / 4e-20 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10009421 77 / 1e-18 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10014262 72 / 3e-17 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1)
Lus10025962 70 / 1e-16 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10021098 66 / 3e-15 AT2G18420 77 / 8e-20 Gibberellin-regulated family protein (.1)
Lus10024338 65 / 1e-14 ND 78 / 3e-20
Lus10042203 55 / 6e-11 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Potri.015G071500.1 pacid=42775371 polypeptide=Potri.015G071500.1.p locus=Potri.015G071500 ID=Potri.015G071500.1.v4.1 annot-version=v4.1
ATGGCAGTGCGTTCGCTTCTTGCTTTGATGGTTTTTGTTTTCTGCCTTGCAGAGGTTTCATCTGATCTCAAGATAGATACCGGAATACTCCATGTTGGTC
AGCTTGTTGTGAGAGGTGGAAACAGGAGGCTCATGCAAGACATAGACTGTGGAGGGTTATGCAAGCAGAGGTGCAGTCTTCACTCAAGGCCTAATGTGTG
CACCAGGGCATGTGGCACCTGCTGTGTAAGGTGCAAGTGTGTGCCGCCTGGGACCTCAGGGAACAGAGAAGTATGTGGAACATGCTATACTGACATGACC
ACCCATGGGAACAAGACCAAGTGTCCATAG
AA sequence
>Potri.015G071500.1 pacid=42775371 polypeptide=Potri.015G071500.1.p locus=Potri.015G071500 ID=Potri.015G071500.1.v4.1 annot-version=v4.1
MAVRSLLALMVFVFCLAEVSSDLKIDTGILHVGQLVVRGGNRRLMQDIDCGGLCKQRCSLHSRPNVCTRACGTCCVRCKCVPPGTSGNREVCGTCYTDMT
THGNKTKCP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G14920 Gibberellin-regulated family p... Potri.015G071500 0 1
AT3G55240 Plant protein 1589 of unknown ... Potri.010G211500 3.00 0.7708
AT5G01225 unknown protein Potri.016G112700 3.16 0.8127
AT1G34010 unknown protein Potri.003G177200 3.87 0.7870
Potri.010G171133 11.48 0.7773
AT1G71140 MATE efflux family protein (.1... Potri.004G093400 15.81 0.8018
AT1G74520 ATHVA22A HVA22 homologue A (.1) Potri.017G139000 17.43 0.7485
AT2G18110 Translation elongation factor... Potri.009G018600 17.88 0.7478
AT3G13275 unknown protein Potri.005G061200 18.43 0.7526
Potri.017G040750 18.70 0.7726
AT1G75060 unknown protein Potri.002G133500 21.49 0.7629

Potri.015G071500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.