Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41340 268 / 8e-93 ATUBC4, UBC4 ubiquitin conjugating enzyme 4 (.1) AT1G63800 266 / 7e-92 UBC5 ubiquitin-conjugating enzyme 5 (.1) AT2G46030 257 / 1e-88 UBC6 ubiquitin-conjugating enzyme 6 (.1) AT2G02760 97 / 5e-26 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G16890 97 / 1e-25 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) AT1G78870 97 / 1e-25 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) AT5G62540 96 / 2e-25 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT1G14400 96 / 3e-25 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT5G53300 94 / 1e-24 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT5G41700 94 / 2e-24 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G101900 [exp] 271 / 5e-94 AT5G41340 292 / 3e-102 ubiquitin conjugating enzyme 4 (.1) Potri.003G129700 [exp] 265 / 1e-91 AT5G41340 284 / 5e-99 ubiquitin conjugating enzyme 4 (.1) Potri.002G161000 [exp] 263 / 8e-91 AT1G63800 288 / 1e-100 ubiquitin-conjugating enzyme 5 (.1) Potri.014G086600 [exp] 259 / 2e-89 AT1G63800 283 / 8e-99 ubiquitin-conjugating enzyme 5 (.1) Potri.013G064400 [exp] 98 / 3e-26 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.011G111400 [exp] 98 / 3e-26 AT1G78870 311 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) Potri.019G039200 [exp] 97 / 6e-26 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.001G392500 [exp] 97 / 6e-26 AT1G78870 310 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) Potri.015G064000 [exp] 96 / 2e-25 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002359 [exp] 301 / 3e-105 AT1G63800 275 / 5e-95 ubiquitin-conjugating enzyme 5 (.1) Lus10042136 [exp] 286 / 1e-99 AT1G63800 267 / 2e-92 ubiquitin-conjugating enzyme 5 (.1) Lus10014763 [exp] 254 / 5e-87 AT1G63800 294 / 6e-103 ubiquitin-conjugating enzyme 5 (.1) Lus10036372 [exp] 246 / 5e-84 AT1G63800 286 / 9e-100 ubiquitin-conjugating enzyme 5 (.1) Lus10032274 [exp] 239 / 1e-81 AT1G63800 278 / 5e-97 ubiquitin-conjugating enzyme 5 (.1) Lus10024638 [exp] 201 / 5e-66 AT1G63800 229 / 2e-77 ubiquitin-conjugating enzyme 5 (.1) Lus10037203 [exp] 98 / 5e-26 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10036727 [exp] 98 / 5e-26 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 96 / 3e-25 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10017654 [exp] 96 / 4e-25 AT1G16890 311 / 5e-111 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.015G073400.1 pacid=42776178 polypeptide=Potri.015G073400.1.p locus=Potri.015G073400 ID=Potri.015G073400.1.v4.1 annot-version=v4.1 ATGTCTTCTCCAAGCAAGAGGAGAGAGATGGATGTCATGAAGTTGATGATGAGTGATTACAATGTGGAGACTATAAATGATGGACTGAATGATTTTAATG TGGAGTTTCATGGTCCTAAAGAAAGCCTTTATGAAGGTGGTGTCTGGAAAATCCATGTTGAGCTTCCTGATGCATATCCTTACAAGTCGCCTTCTATTGG GTTTGTGAACAAGATATTCCACCCAAATGTTGATGAACTTTCTGGTTCTGTATGCTTGGATGTAATCAACCAGTCATGGAGTCCAATGTTTGATCTTTTA AATGTTTTTGAAGTTTTCTTGCCACAGCTCTTGATTTATCCAAATCCTTCAGACCCCCTCAATGGTGATGCAGCTTCATTGATGATGAAGGATAAAGAAC AATATGATCAGAAAGTGAAAGAGTATTGTGAAAGATATGCAAAAAAGGAGCATATTATGAACTCCACGGGCGAAGAGCTGAGTGACGAGGAGGATGTCAG TGATGAAGAAAGTGGATCCAGTGATGAGGAAGATGAGATTGCTGGGCATGTAGACCCTTAA
AA sequence Show only first row Show all	>Potri.015G073400.1 pacid=42776178 polypeptide=Potri.015G073400.1.p locus=Potri.015G073400 ID=Potri.015G073400.1.v4.1 annot-version=v4.1 MSSPSKRREMDVMKLMMSDYNVETINDGLNDFNVEFHGPKESLYEGGVWKIHVELPDAYPYKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLL NVFEVFLPQLLIYPNPSDPLNGDAASLMMKDKEQYDQKVKEYCERYAKKEHIMNSTGEELSDEEDVSDEESGSSDEEDEIAGHVDP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G41340		ATUBC4, UBC4	ubiquitin conjugating enzyme 4...		Potri.015G073400 [exp]	0	1
AT5G40810			Cytochrome C1 family (.1.2)		Potri.009G165000 [exp]	3.60	0.8282
AT2G41475			Embryo-specific protein 3, (AT...		Potri.018G131800 [exp]	14.83	0.7589
AT2G26210			Ankyrin repeat family protein ...		Potri.006G217100 [exp]	17.57	0.7358
AT5G39850			Ribosomal protein S4 (.1)		Potri.011G094500 [exp]	19.39	0.8020
AT5G59613			unknown protein		Potri.010G207600 [exp]	21.58	0.8113
AT1G47420		SDH5	succinate dehydrogenase 5 (.1)		Potri.014G032400 [exp]	21.84	0.8108
AT4G36130			Ribosomal protein L2 family (....		Potri.007G013101 [exp]	23.66	0.8040
AT5G24510			60S acidic ribosomal protein f...		Potri.002G179400 [exp]	29.93	0.8089
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.002G257500 [exp]	31.36	0.7948
AT3G48590	CCAAT	NF-YC1, ATHAP5A...	"nuclear factor Y, subunit C1"...		Potri.012G098500 [exp]	32.49	0.7058

Compare expression of checked genes

Potri.015G073400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.