Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62850 291 / 3e-100 ATVEX1, SWEET5, AtSWEET5 VEGETATIVE CELL EXPRESSED1, Nodulin MtN3 family protein (.1) AT3G28007 238 / 2e-79 SWEET4, AtSWEET4 Nodulin MtN3 family protein (.1) AT4G10850 235 / 7e-78 SWEET7, AtSWEET7 Nodulin MtN3 family protein (.1) AT1G66770 216 / 3e-70 SWEET6, AtSWEET6 Nodulin MtN3 family protein (.1) AT5G40260 198 / 2e-63 SWEET8, AtSWEET8 Nodulin MtN3 family protein (.1.2) AT1G21460 196 / 1e-62 SWEET1, AtSWEET1 Nodulin MtN3 family protein (.1) AT4G15920 188 / 1e-59 SWEET17, AtSWEET17 Nodulin MtN3 family protein (.1) AT3G16690 169 / 3e-52 SWEET16, AtSWEET16 Nodulin MtN3 family protein (.1) AT5G53190 168 / 2e-51 SWEET3, AtSWEET3 Nodulin MtN3 family protein (.1) AT5G13170 162 / 5e-49 SAG29, SWEET15, AtSWEET15 senescence-associated gene 29 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G344300 [exp] 246 / 2e-82 AT3G28007 239 / 2e-79 Nodulin MtN3 family protein (.1) Potri.003G143100 [exp] 228 / 3e-75 AT4G10850 262 / 4e-88 Nodulin MtN3 family protein (.1) Potri.005G187300 [exp] 193 / 1e-61 AT1G21460 365 / 6e-129 Nodulin MtN3 family protein (.1) Potri.002G072800 [exp] 182 / 4e-57 AT1G21460 345 / 4e-121 Nodulin MtN3 family protein (.1) Potri.002G072700 [exp] 182 / 4e-57 AT1G21460 345 / 5e-121 Nodulin MtN3 family protein (.1) Potri.002G072600 [exp] 182 / 4e-57 AT1G21460 345 / 4e-121 Nodulin MtN3 family protein (.1) Potri.012G031400 [exp] 167 / 1e-51 AT5G53190 310 / 3e-107 Nodulin MtN3 family protein (.1) Potri.005G023900 [exp] 167 / 2e-51 AT3G16690 190 / 2e-60 Nodulin MtN3 family protein (.1) Potri.015G021900 [exp] 164 / 3e-50 AT5G53190 286 / 9e-98 Nodulin MtN3 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034880 [exp] 307 / 3e-106 AT5G62850 291 / 5e-100 VEGETATIVE CELL EXPRESSED1, Nodulin MtN3 family protein (.1) Lus10033416 [exp] 294 / 6e-101 AT5G62850 283 / 8e-97 VEGETATIVE CELL EXPRESSED1, Nodulin MtN3 family protein (.1) Lus10002364 [exp] 286 / 9e-98 AT5G62850 268 / 7e-91 VEGETATIVE CELL EXPRESSED1, Nodulin MtN3 family protein (.1) Lus10042131 [exp] 268 / 9e-91 AT5G62850 265 / 2e-89 VEGETATIVE CELL EXPRESSED1, Nodulin MtN3 family protein (.1) Lus10003200 [exp] 233 / 8e-77 AT4G10850 255 / 1e-85 Nodulin MtN3 family protein (.1) Lus10032426 [exp] 224 / 3e-73 AT4G10850 254 / 7e-85 Nodulin MtN3 family protein (.1) Lus10022226 [exp] 223 / 4e-73 AT5G62850 223 / 4e-73 VEGETATIVE CELL EXPRESSED1, Nodulin MtN3 family protein (.1) Lus10017302 [exp] 223 / 4e-73 AT4G10850 254 / 4e-85 Nodulin MtN3 family protein (.1) Lus10018932 [exp] 193 / 1e-61 AT1G21460 365 / 6e-129 Nodulin MtN3 family protein (.1) Lus10028634 [exp] 191 / 9e-61 AT1G21460 359 / 1e-126 Nodulin MtN3 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0141 [poplar] [flax] MtN3-like PF03083 [poplar] [flax] MtN3_slv Sugar efflux transporter for intercellular exchange
Representative CDS sequence Show only first row Show all	>Potri.015G074300.1 pacid=42776179 polypeptide=Potri.015G074300.1.p locus=Potri.015G074300 ID=Potri.015G074300.1.v4.1 annot-version=v4.1 ATGACTGACACAGGCACTGTTAGAACCATTGTTGGCATCGTTGGAAATGTTATATCTTTCCTCCTATTTCTCTCCCCCATTCCCACTTTTGTGAGGATAA TAAAGGAAAAGGCAGTGAAGGATTTCAAATCCGATCCCTATGTAGCCACCTTGCTCAATTGCGCAATGTGGATCTTCTATGGCTTACCGTTCATCACCCA TGACAACACTCTTGTGGTTACAATCAACGGTATTGGTTTTGTCATAGAGTGTATCTATGTGGCCATCTTCTTCATATTCTCTCCCGGGAAAAAGAAAACC CGGATCATCATTGAACTGCTTATTGAAGTGATCTTCATGGTCATCGTAATCCTGATCACCGTTTTCGCCTTCCATACCATGAAAACAAGGGCTTTGTTTA TTGGGATATTGTGTATCATCTTCAACGTATTTATGTACTCGTCACCATTGACAGTCATGAGAATGGTAATAAAGACAAAGAGTGTCAAGTACATGCCATT CTATCTCTCTCTCGCCAACTTTACCAACGGACTGATTTGGGTGATCTACGGACTACTTGATTTTGATATCAACCTCGTGCTTCCCAATGGCTTGGGTGCG TTATCTGGGCTGATTCAGCTCATACTCTATGGAATCTACTGCAGATCGACCAAATCGGATGATGATGATGATGTTAGTGGAAACCGATCTGTGGTTGAAC TCTCCTCTACTTAG
AA sequence Show only first row Show all	>Potri.015G074300.1 pacid=42776179 polypeptide=Potri.015G074300.1.p locus=Potri.015G074300 ID=Potri.015G074300.1.v4.1 annot-version=v4.1 MTDTGTVRTIVGIVGNVISFLLFLSPIPTFVRIIKEKAVKDFKSDPYVATLLNCAMWIFYGLPFITHDNTLVVTINGIGFVIECIYVAIFFIFSPGKKKT RIIIELLIEVIFMVIVILITVFAFHTMKTRALFIGILCIIFNVFMYSSPLTVMRMVIKTKSVKYMPFYLSLANFTNGLIWVIYGLLDFDINLVLPNGLGA LSGLIQLILYGIYCRSTKSDDDDDVSGNRSVVELSST

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G62850		ATVEX1, SWEET5,...	VEGETATIVE CELL EXPRESSED1, No...		Potri.015G074300 [exp]	0	1
AT2G31940			unknown protein		Potri.009G024500 [exp]	4.89	0.7907
AT3G24060			Plant self-incompatibility pro...		Potri.001G053200 [exp]	6.78	0.7925
					Potri.005G209300 [exp]	10.39	0.7078
AT2G20390			unknown protein		Potri.014G193150 [exp]	12.40	0.7530
AT4G39900			unknown protein		Potri.007G093200 [exp]	14.69	0.7510
AT1G09812			unknown protein		Potri.003G006900 [exp]	15.32	0.7829
AT3G21510		ATHP3, AHP1	histidine-containing phosphotr...		Potri.005G040400 [exp]	16.43	0.7455	Pt-HPT2.3
AT3G63530		BB2, BB	BIG BROTHER, RING/U-box superf...		Potri.001G019600 [exp]	20.44	0.6925
AT5G62200			Embryo-specific protein 3, (AT...		Potri.012G130800 [exp]	22.27	0.6345
AT2G02850		ARPN	plantacyanin (.1)		Potri.001G209300 [exp]	23.15	0.7863	Pt-BABL.1

Compare expression of checked genes

Potri.015G074300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.