Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25355 106 / 2e-29 PNAS-3 related (.1.2) AT4G32175 105 / 6e-29 PNAS-3 related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G080300 [exp] 128 / 7e-38 AT4G32175 382 / 8e-136 PNAS-3 related (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000238 [exp] 114 / 7e-33 AT4G32175 231 / 8e-78 PNAS-3 related (.1) Lus10042121 [exp] 113 / 8e-32 AT4G32175 345 / 3e-121 PNAS-3 related (.1) Lus10002375 [exp] 113 / 8e-32 AT4G32175 348 / 2e-122 PNAS-3 related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0007 [poplar] [flax] KH PF15985 [poplar] [flax] KH_6 KH domain
Representative CDS sequence Show only first row Show all	>Potri.015G075400.2 pacid=42775667 polypeptide=Potri.015G075400.2.p locus=Potri.015G075400 ID=Potri.015G075400.2.v4.1 annot-version=v4.1 ATGAGTTGGTATCTGCATAATTATTTCAAATCTCAATTACTCAATCAATGCTCGCTTCCTTCCCTTCCAATATCATCCATACAGCTTGCCATTGAACAAG TATTGGCTCATTACTTTCAACAAGTGTTCTTCTGCTACTTACGAGGTAGGTGCTCTGCTTTATGTACGAGTTGTGAAGGCAAATCCTGGAAAGTAATGCT GAGCTCACCAACATGTCCAGTTCTTGAGGCACTTGGCAAGAAGCTCTCCTTTGAGATAGCAGTTGGCTTAAATGGCCGTGTTTGGGTGAAAGCTGATTCT CCATCAACAGTTATTATTGTTGTCAATGCAATTATCAAGTCGGAGTCTTTAAGTGGGGCACAGCAGAAAATTATGGCAGAGAAATTACTTCAGAAAATTC AGAATGATTAA
AA sequence Show only first row Show all	>Potri.015G075400.2 pacid=42775667 polypeptide=Potri.015G075400.2.p locus=Potri.015G075400 ID=Potri.015G075400.2.v4.1 annot-version=v4.1 MSWYLHNYFKSQLLNQCSLPSLPISSIQLAIEQVLAHYFQQVFFCYLRGRCSALCTSCEGKSWKVMLSSPTCPVLEALGKKLSFEIAVGLNGRVWVKADS PSTVIIVVNAIIKSESLSGAQQKIMAEKLLQKIQND

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G25355			PNAS-3 related (.1.2)		Potri.015G075400 [exp]	0	1
AT2G33385		ARPC2B	actin-related protein C2B (.1....		Potri.008G170800 [exp]	2.23	0.8764
AT5G19860			Protein of unknown function, D...		Potri.003G217200 [exp]	3.46	0.8378
AT1G22060			unknown protein		Potri.002G091700 [exp]	3.74	0.8615
AT1G32400		TOM2A	tobamovirus multiplication 2A ...		Potri.003G087800 [exp]	5.91	0.8006	Pt-TOM2.1
AT3G05270			Plant protein of unknown funct...		Potri.005G070400 [exp]	7.74	0.8559
AT5G47120		ATBI-1, ATBI1	ARABIDOPSIS BAX INHIBITOR 1, B...		Potri.001G151800 [exp]	8.36	0.7982	ATBI.1
AT3G62020		GLP10	germin-like protein 10 (.1.2)		Potri.002G184900 [exp]	9.79	0.8047	GLP10.1
AT2G03890		UBDKGAMMA7, ATP...	UBIQUITIN-LIKE DOMAIN KINASE G...		Potri.010G137400 [exp]	9.94	0.7964
AT3G57690		AGP23, ATAGP23	ARABINOGALACTAN-PROTEIN 23, ar...		Potri.006G056200 [exp]	11.22	0.7985
AT1G79590		ATSYP52, SYP52	syntaxin of plants 52 (.1.2)		Potri.016G030100 [exp]	18.89	0.7045

Compare expression of checked genes

Potri.015G075400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.