Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06040 133 / 3e-39 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) AT4G37660 97 / 2e-25 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) AT4G36420 92 / 2e-23 Ribosomal protein L12 family protein (.1) AT1G70190 89 / 6e-22 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2) AT2G03130 59 / 1e-11 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) AT3G27850 59 / 5e-11 RPL12-C ribosomal protein L12-C (.1) AT3G27830 59 / 6e-11 RPL12-A ribosomal protein L12-A (.1) AT3G27840 49 / 2e-07 RPL12-B ribosomal protein L12-B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G224300 [exp] 105 / 1e-28 AT4G37660 154 / 4e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Potri.007G019100 [exp] 100 / 9e-27 AT4G36420 127 / 2e-37 Ribosomal protein L12 family protein (.1) Potri.003G074800 [exp] 95 / 3e-24 AT1G70190 204 / 1e-66 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2) Potri.001G346100 [exp] 61 / 1e-11 AT3G27830 146 / 1e-44 ribosomal protein L12-A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031756 [exp] 201 / 5e-66 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) Lus10031180 [exp] 197 / 1e-64 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) Lus10000093 [exp] 101 / 5e-27 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Lus10023839 [exp] 101 / 5e-27 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Lus10021011 [exp] 98 / 2e-25 AT4G37660 157 / 3e-49 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Lus10041783 [exp] 97 / 4e-25 AT4G36420 174 / 5e-56 Ribosomal protein L12 family protein (.1) Lus10028336 [exp] 94 / 3e-24 AT4G36420 176 / 1e-56 Ribosomal protein L12 family protein (.1) Lus10036228 [exp] 93 / 2e-23 AT1G70190 238 / 3e-80 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2) Lus10038367 [exp] 92 / 4e-23 AT1G70190 243 / 3e-82 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2) Lus10013078 [exp] 64 / 8e-13 AT3G27830 175 / 7e-56 ribosomal protein L12-A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00542 [poplar] [flax] Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.015G077200.2 pacid=42775401 polypeptide=Potri.015G077200.2.p locus=Potri.015G077200 ID=Potri.015G077200.2.v4.1 annot-version=v4.1 ATGAAGTTTATTGCGCTTGCCAGATCAGTTTGTGCACATCATCCTGCTCTCCGTGAAATAACTGGACCTTTGCAGGTTCGTTATTTCCAGCATGATTTTG TTCCTAGGGATCCCAAGACCAAGCCTAAAAAGTACAAGTATCCGCTGTACTATGATCCATATGGACCTAGACCTCCACCCTCAGAAAAGATCATTGAAAT CGCTGAGCGCATTGCTGCCTTACCCCCTGAAGAGCGATCCCAAATTGGTTCTGCTCTTGGGTACAAACTAAAGCATCCAAAACTGCAGCCAATTTCAACA GAGGGCATGGACCTGGGTTCCCAGGGAGGAGAGGCTGCTGCCAGTGCTGCGAAGGTTGAAGAAAAGAAGGAGAAAACAGCCTTTGATGTGAAGTTGGAGA AGTTCGACGCAGCAGCAAAAATTAAGGTGATTAAAGAAGTCAGAGCTTTTACTAATTTGGGATTGAAGGAGGCCAAAGACCTGGTTGAGAAGGTTCCTTG TGTGCTTAAACAAGGCGTCACTAAAGATGAAGCAAATGGCATAATAGAGAAGATAAAAGCTGCTGGAGGAGTTGCAGTTATGGAGTGA
AA sequence Show only first row Show all	>Potri.015G077200.2 pacid=42775401 polypeptide=Potri.015G077200.2.p locus=Potri.015G077200 ID=Potri.015G077200.2.v4.1 annot-version=v4.1 MKFIALARSVCAHHPALREITGPLQVRYFQHDFVPRDPKTKPKKYKYPLYYDPYGPRPPPSEKIIEIAERIAALPPEERSQIGSALGYKLKHPKLQPIST EGMDLGSQGGEAAASAAKVEEKKEKTAFDVKLEKFDAAAKIKVIKEVRAFTNLGLKEAKDLVEKVPCVLKQGVTKDEANGIIEKIKAAGGVAVME

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G06040			Ribosomal protein L12/ ATP-dep...		Potri.015G077200 [exp]	0	1
AT2G15000			unknown protein		Potri.009G093400 [exp]	2.00	0.8650
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Potri.005G226300 [exp]	4.00	0.8228
AT4G35490		MRPL11	mitochondrial ribosomal protei...		Potri.007G058600 [exp]	4.24	0.8318
AT3G57785			unknown protein		Potri.006G056900 [exp]	4.79	0.7621
AT1G10865			unknown protein		Potri.010G248800 [exp]	5.65	0.7925
AT4G25315			Expressed protein (.1.2)		Potri.004G189300 [exp]	5.91	0.8215
AT2G20060			Ribosomal protein L4/L1 family...		Potri.004G004800 [exp]	6.48	0.7932
AT5G39600			unknown protein		Potri.004G228566 [exp]	7.34	0.8302
AT4G17180			O-Glycosyl hydrolases family 1...		Potri.006G002100 [exp]	8.36	0.7834
AT1G61580		RPL3B, ARP2	ARABIDOPSIS RIBOSOMAL PROTEIN ...		Potri.003G008300 [exp]	10.39	0.7830

Compare expression of checked genes

Potri.015G077200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.