Plant FIBer expression Database

Potri.015G078351 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32990 39 / 5e-05 Transducin/WD40 repeat-like superfamily protein (.1)
AT2G26060 37 / 0.0004 EMB1345 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G212800
[exp]
40 / 2e-05 AT2G26060 530 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.001G221000
[exp]
36 / 0.0005 AT2G26060 523 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.015G078351.1 pacid=42776050 polypeptide=Potri.015G078351.1.p locus=Potri.015G078351 ID=Potri.015G078351.1.v4.1 annot-version=v4.1
ATGATTACCTGTAGAGATGATCTTGCACTAAAAATATGGGAAACAGATGTTGAAAGGATGTGTAATCGGGTGATGAGCTTGCGTCTTGGTGAGAAACATG
TTCTTTATGTATATTGGATATTCTGCTCCTCATTTTATTACAGCAGATTGAAATGTTCCATGGACGAGAACAGTACTACCTTAGAGGATAATGTAAGTAA
TTCTCATCTTAGTTAA
AA sequence
>Potri.015G078351.1 pacid=42776050 polypeptide=Potri.015G078351.1.p locus=Potri.015G078351 ID=Potri.015G078351.1.v4.1 annot-version=v4.1
MITCRDDLALKIWETDVERMCNRVMSLRLGEKHVLYVYWIFCSSFYYSRLKCSMDENSTTLEDNVSNSHLS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.015G078351
[exp]
0 1
AT5G25360 unknown protein Potri.006G068600
[exp]
3.46 0.7251
AT5G17690 AtLHP1, LHP1, T... TERMINAL FLOWER 2, LIKE HETERO... Potri.013G070400
[exp]
8.12 0.7259
Potri.006G140801
[exp]
27.20 0.7214
AT5G64010 unknown protein Potri.005G064951
[exp]
31.41 0.6297
Potri.001G020250
[exp]
34.64 0.6897
Potri.019G128725
[exp]
35.66 0.7026
AT2G28080 UDP-Glycosyltransferase superf... Potri.009G008100
[exp]
38.98 0.6886
Potri.012G119350
[exp]
42.42 0.6897
AT5G19473 RPM1-interacting protein 4 (RI... Potri.009G067600
[exp]
47.11 0.6579
AT4G19150 Ankyrin repeat family protein ... Potri.001G130500
[exp]
47.69 0.6156

Potri.015G078351 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.