Potri.015G078801 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17990 84 / 3e-19 PAT1, TRP1 PHOSPHORIBOSYLANTHRANILATE TRANSFERASE 1, tryptophan biosynthesis 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G082700 186 / 7e-58 AT5G17990 538 / 0.0 PHOSPHORIBOSYLANTHRANILATE TRANSFERASE 1, tryptophan biosynthesis 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042050 83 / 5e-19 AT5G17990 501 / 6e-176 PHOSPHORIBOSYLANTHRANILATE TRANSFERASE 1, tryptophan biosynthesis 1 (.1)
Lus10018054 72 / 4e-15 AT5G17990 514 / 0.0 PHOSPHORIBOSYLANTHRANILATE TRANSFERASE 1, tryptophan biosynthesis 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Representative CDS sequence
>Potri.015G078801.1 pacid=42775546 polypeptide=Potri.015G078801.1.p locus=Potri.015G078801 ID=Potri.015G078801.1.v4.1 annot-version=v4.1
ATGGCAGCCAGTCTATCTGCAACTTCTCTTTCTATGATATCTCAGCGACCCAAATCGCCAATTCGTGATTTTGAAGACAAAAATTGCTGCTTCTGGACTC
GACCGAGTTGCTACCTGAAGCAAAGAAACATAATCAGAAATGTAAGTGGAGGTACAAGCAGAAAAGGTACGACTCTGGTCTCTGCTTTACTGTCTACTAT
TTCTAGGACATCAGCTTCTACAATACCTGCATTCAATGAGTTGATTGAATCCTTGATTATTAAGGTGGATTTGTCAGAATCTGAGGCTGAAGCATCATTA
GATTATTTACTCGATGATGCTAGTGAGGCCGTGATCATTGCTTTCTTGGTACTGCTGAGAGCCAAGGGAGAGACTTTTGAAGAGTTAAGTTTAGTGCATT
TATTGCTTTTACAAGTAGGCAAGTATATTCCAAGCGTCTCTCCTTTAAAAGATTGTTGGATTGGCAAGGGCAATGTTTAA
AA sequence
>Potri.015G078801.1 pacid=42775546 polypeptide=Potri.015G078801.1.p locus=Potri.015G078801 ID=Potri.015G078801.1.v4.1 annot-version=v4.1
MAASLSATSLSMISQRPKSPIRDFEDKNCCFWTRPSCYLKQRNIIRNVSGGTSRKGTTLVSALLSTISRTSASTIPAFNELIESLIIKVDLSESEAEASL
DYLLDDASEAVIIAFLVLLRAKGETFEELSLVHLLLLQVGKYIPSVSPLKDCWIGKGNV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G17990 PAT1, TRP1 PHOSPHORIBOSYLANTHRANILATE TRA... Potri.015G078801 0 1
AT2G41140 CRK1, ATCRK1, A... CDPK-related kinase 1 (.1) Potri.006G040500 1.00 0.8240 CRK1.1
AT2G21120 Protein of unknown function (D... Potri.019G001100 5.19 0.7986
AT3G06620 PAS domain-containing protein ... Potri.010G146000 8.36 0.8087
Potri.019G131050 12.00 0.8135
AT1G70570 anthranilate phosphoribosyltra... Potri.010G044900 13.26 0.7869
AT1G01220 AtFKGP Arabidopsis thaliana L-fucokin... Potri.014G101400 14.49 0.7648
AT1G09060 Zinc finger, RING-type;Transcr... Potri.013G019000 14.69 0.8098
Potri.001G422900 16.43 0.7673
AT5G19330 ARIA ARM repeat protein interacting... Potri.008G150100 20.49 0.7867
AT4G13640 GARP UNE16 unfertilized embryo sac 16, Ho... Potri.014G172101 22.91 0.7307

Potri.015G078801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.