Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19090 172 / 5e-51 CRK1, RKF2 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1) AT5G40380 136 / 1e-37 CRK42 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1) AT1G70530 132 / 4e-36 CRK3 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1) AT1G70520 115 / 4e-30 ASG6, CRK2 ALTERED SEED GERMINATION 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 2 (.1) AT4G28670 110 / 2e-28 Protein kinase family protein with domain of unknown function (DUF26) (.1) AT1G16670 103 / 2e-26 Protein kinase superfamily protein (.1) AT4G23160 103 / 6e-26 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT1G61610 102 / 1e-25 S-locus lectin protein kinase family protein (.1) AT1G11340 102 / 1e-25 S-locus lectin protein kinase family protein (.1) AT4G23140 101 / 3e-25 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G087000 [exp] 264 / 2e-85 AT5G40380 567 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1) Potri.001G348000 [exp] 155 / 3e-44 AT5G40380 729 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1) Potri.010G043900 [exp] 129 / 4e-35 AT1G70530 805 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1) Potri.004G024632 [exp] 110 / 4e-29 AT4G23180 527 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.007G056000 [exp] 111 / 8e-29 AT4G28670 579 / 0.0 Protein kinase family protein with domain of unknown function (DUF26) (.1) Potri.004G024404 [exp] 110 / 3e-28 AT4G23180 671 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025800 [exp] 109 / 4e-28 AT4G23180 648 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024800 [exp] 109 / 5e-28 AT4G23180 663 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G028701 [exp] 109 / 6e-28 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029122 [exp] 139 / 2e-38 AT1G70530 789 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1) Lus10013040 [exp] 138 / 3e-38 AT1G70530 788 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1) Lus10008764 [exp] 131 / 9e-37 AT5G40380 426 / 6e-145 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1) Lus10018378 [exp] 100 / 8e-27 AT4G23180 180 / 1e-53 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10006745 [exp] 103 / 6e-26 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10015093 [exp] 97 / 1e-25 AT4G23160 147 / 1e-41 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10030901 [exp] 102 / 2e-25 AT1G70520 803 / 0.0 ALTERED SEED GERMINATION 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 2 (.1) Lus10029123 [exp] 101 / 5e-25 AT1G70520 822 / 0.0 ALTERED SEED GERMINATION 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 2 (.1) Lus10030589 [exp] 101 / 5e-25 AT1G70520 813 / 0.0 ALTERED SEED GERMINATION 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 2 (.1) Lus10006746 [exp] 100 / 2e-24 AT1G11340 836 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.015G079200.1 pacid=42775327 polypeptide=Potri.015G079200.1.p locus=Potri.015G079200 ID=Potri.015G079200.1.v4.1 annot-version=v4.1 ATGGCTCCTGAGTATCTTGTTCGAGGGCAGCTAACAGAGAAAGCTGATGTTTATGGTTTTGGGGTTCTAGTTCTTGAGACTGCAACTGGTAGAAAGAACA GTGTGTTCTCACAGGGATCGAGTTCAATTCTACATTCTGTTTGGAAGCATTACAAGGTAAAGACAATTACAGACATGATTGATCCTGGCTTAAAAGATAG TTTTCCAGAGAAACAGGCAGAAACTGTGCTTCAAATAGGACTTCTATGCACGCAAGCTTCTCCAAGACTAAGACCGTTCATGAATGAAGTAGTTAGCATG CTCGCCAATGCCAAAAGTGAAATTCCCTCTCCAAAGCAACCTCCATTCTTGAATGCTAGCGTTCTTAGTCCAGATGGCAGCACAGAAAGTTGCATTACAG AAGTATCTTTTACATGTAATTCAGTCATAGATCAGCAAACAAAGGCTCAAGCAGTACCCTTAAATGACCCTCCAAATTCACAAGCTACAGATGGTCCCGG ATCACGAAATTCTTCGATCCTAGAACAAACTAAGAGAAATTAG
AA sequence Show only first row Show all	>Potri.015G079200.1 pacid=42775327 polypeptide=Potri.015G079200.1.p locus=Potri.015G079200 ID=Potri.015G079200.1.v4.1 annot-version=v4.1 MAPEYLVRGQLTEKADVYGFGVLVLETATGRKNSVFSQGSSSILHSVWKHYKVKTITDMIDPGLKDSFPEKQAETVLQIGLLCTQASPRLRPFMNEVVSM LANAKSEIPSPKQPPFLNASVLSPDGSTESCITEVSFTCNSVIDQQTKAQAVPLNDPPNSQATDGPGSRNSSILEQTKRN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G19090		CRK1, RKF2	CYSTEINE-RICH RLK \(RECEPTOR-L...		Potri.015G079200 [exp]	0	1
AT1G78720			SecY protein transport family ...		Potri.011G114200 [exp]	14.49	0.6948
AT5G53730			Late embryogenesis abundant (L...		Potri.015G002400 [exp]	15.39	0.7440
AT5G58200			Calcineurin-like metallo-phosp...		Potri.018G111500 [exp]	15.49	0.6948
AT5G50790		SWEET10, AtSWEE...	Nodulin MtN3 family protein (....		Potri.015G101500 [exp]	19.94	0.7398
					Potri.001G174350 [exp]	22.58	0.6680
					Potri.012G136500 [exp]	40.21	0.6324
AT1G29160	DOF	AtDof1. 5	Dof-type zinc finger DNA-bindi...		Potri.011G065900 [exp]	78.96	0.6515
AT5G26330			Cupredoxin superfamily protein...		Potri.004G171100 [exp]	121.06	0.5699

Compare expression of checked genes

Potri.015G079200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.