Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63060 318 / 3e-110 Sec14p-like phosphatidylinositol transfer family protein (.1) AT4G08690 86 / 2e-19 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT1G01630 80 / 1e-17 Sec14p-like phosphatidylinositol transfer family protein (.1) AT1G22180 72 / 2e-14 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT1G75170 68 / 4e-13 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT4G36640 67 / 8e-13 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT1G14820 57 / 1e-09 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT1G05370 54 / 4e-08 Sec14p-like phosphatidylinositol transfer family protein (.1) AT3G22410 50 / 6e-07 Sec14p-like phosphatidylinositol transfer family protein (.1) AT4G36490 43 / 0.0002 ATSFH12 SEC14-like 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G088350 [exp] 148 / 6e-45 AT5G63060 106 / 7e-29 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.003G162100 [exp] 76 / 4e-16 AT1G01630 356 / 2e-125 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.002G261000 [exp] 75 / 2e-15 AT1G75170 427 / 3e-152 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.001G068000 [exp] 74 / 3e-15 AT1G01630 361 / 3e-127 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.017G063966 [exp] 74 / 4e-15 AT1G01630 340 / 2e-118 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.002G093400 [exp] 74 / 8e-15 AT4G08690 375 / 5e-130 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Potri.005G123200 [exp] 68 / 4e-13 AT1G75170 414 / 9e-147 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.008G135600 [exp] 65 / 3e-12 AT1G14820 323 / 2e-112 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.013G068700 [exp] 63 / 2e-11 AT1G22180 351 / 6e-121 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027685 [exp] 335 / 4e-116 AT5G63060 334 / 1e-115 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10039952 [exp] 315 / 5e-109 AT5G63060 329 / 2e-114 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10022428 [exp] 78 / 8e-17 AT1G01630 323 / 1e-112 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10040252 [exp] 78 / 1e-16 AT1G01630 319 / 8e-111 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10033464 [exp] 78 / 2e-16 AT4G08690 378 / 4e-132 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Lus10004684 [exp] 77 / 2e-16 AT1G01630 326 / 2e-113 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10020911 [exp] 77 / 6e-16 AT4G08690 376 / 1e-130 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Lus10016733 [exp] 75 / 1e-15 AT1G01630 325 / 2e-113 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10010804 [exp] 71 / 5e-14 AT1G75170 393 / 7e-139 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10001584 [exp] 69 / 1e-13 AT1G14820 320 / 2e-111 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0512 [poplar] [flax] CRAL_TRIO PF00650 [poplar] [flax] CRAL_TRIO CRAL/TRIO domain
Representative CDS sequence Show only first row Show all	>Potri.015G080100.1 pacid=42775998 polypeptide=Potri.015G080100.1.p locus=Potri.015G080100 ID=Potri.015G080100.1.v4.1 annot-version=v4.1 ATGGCTATTCGCACGTGTCTCAATCTTGGCCGTCCACAAATTGCTCCTGTCACTTTGACTAAAAGTCCCTCTCGAAACTGCAAATTCTCAGTTCAGAGTT GCAGTTTAAGTTCTAATCAATCCCACAAGCAACTGATTGTGGAAGTAAAGGAGAAGCTTGGAAGAGATTACCATAGTCTACCAGTAGGGAAAAATGGACG AGATGATGAAGAAATGATCCTTTGGTTTCTGAAAGACCGGAAATTTTCTGTGGATGAAGCTGTTTCAAAATTGACCAAAGCCATTAAATGGCGTGAGGAA TTTAAAGTGTCGGAACTGTCTGAGGAGTCAGTGAAAAGTATAGCAGACACTGGAAAAGCCTACGTGCATGATTCTCTTGATGTTTATGGAAAGCCAGTGC TTATAGTAGTGGCATCCAAGCACCTTCCTGCTGTGCATGATCCCGTTGAGGATGAGAAACTGTGTGTTTTTCTAATTGAGAAGGCATTGAGAAAGCTCGC AGCTGGGAAAGAACAAATATTAGGAATTATTGATCTCCGGGGATTTAGTACTAGGAACGCAGATCTTAAGTTCTTGACCTTTCTGTTTGATGTAATTTAC TACTATTATCCGAAGCGGTTGGGCCAAGTCCTCTTTGTGGAAGCCCCTTTTATATTTAAGCCAATATGGCAAGTAGCCAAGCCTCTGTTAAGATCGTATA CTTCTCTGGTGAGATTTTGTTCTGTGGAGACGGTGAGGAAGGAATACTTTACAGAAGAAACTTTGCCGGCAAACTTTAGAGAAAAGACACTCTGA
AA sequence Show only first row Show all	>Potri.015G080100.1 pacid=42775998 polypeptide=Potri.015G080100.1.p locus=Potri.015G080100 ID=Potri.015G080100.1.v4.1 annot-version=v4.1 MAIRTCLNLGRPQIAPVTLTKSPSRNCKFSVQSCSLSSNQSHKQLIVEVKEKLGRDYHSLPVGKNGRDDEEMILWFLKDRKFSVDEAVSKLTKAIKWREE FKVSELSEESVKSIADTGKAYVHDSLDVYGKPVLIVVASKHLPAVHDPVEDEKLCVFLIEKALRKLAAGKEQILGIIDLRGFSTRNADLKFLTFLFDVIY YYYPKRLGQVLFVEAPFIFKPIWQVAKPLLRSYTSLVRFCSVETVRKEYFTEETLPANFREKTL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G63060			Sec14p-like phosphatidylinosit...		Potri.015G080100 [exp]	0	1
AT1G22750			unknown protein		Potri.005G198600 [exp]	2.44	0.7650
AT3G23600			alpha/beta-Hydrolases superfam...		Potri.008G201400 [exp]	3.87	0.7607
AT2G25100			Polynucleotidyl transferase, r...		Potri.008G019800 [exp]	4.89	0.7878
AT1G14685	BBR_BPC	BBR/BPC2, ATBPC...	basic pentacysteine 2 (.1.2.3)		Potri.012G040700 [exp]	5.74	0.7254	GBP.6
AT5G10730			NAD(P)-binding Rossmann-fold s...		Potri.004G106300 [exp]	8.36	0.6679
AT1G66520		PDE194	pigment defective 194, formylt...		Potri.017G123300 [exp]	8.48	0.7392
AT3G19850			Phototropic-responsive NPH3 fa...		Potri.010G170900 [exp]	12.40	0.7570
AT1G28100			unknown protein		Potri.003G163800 [exp]	12.64	0.7638
AT3G26744	bHLH	SCRM, ATICE1, I...	SCREAM, A. THALIANA INDUCER OF...		Potri.015G105200 [exp]	14.69	0.7232
AT1G23710			Protein of unknown function (D...		Potri.018G096600 [exp]	15.29	0.7605

Compare expression of checked genes

Potri.015G080100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.