Potri.015G083100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47740 112 / 6e-30 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT2G45910 57 / 4e-09 U-box domain-containing protein kinase family protein (.1)
AT3G61410 51 / 1e-07 unknown protein
AT5G61550 51 / 3e-07 U-box domain-containing protein kinase family protein (.1.2)
AT3G61390 49 / 7e-07 RING/U-box superfamily protein (.1.2)
AT4G25160 49 / 1e-06 U-box domain-containing protein kinase family protein (.1)
AT4G31230 47 / 4e-06 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT5G65500 47 / 5e-06 U-box domain-containing protein kinase family protein (.1)
AT5G57035 47 / 7e-06 U-box domain-containing protein kinase family protein (.1)
AT2G24370 46 / 1e-05 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G084700 341 / 7e-120 AT5G47740 124 / 1e-34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.006G003900 113 / 4e-30 AT5G47740 215 / 3e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.014G084900 67 / 2e-12 AT2G45910 857 / 0.0 U-box domain-containing protein kinase family protein (.1)
Potri.002G160200 65 / 6e-12 AT2G45910 650 / 0.0 U-box domain-containing protein kinase family protein (.1)
Potri.009G030400 62 / 8e-11 AT2G45910 398 / 5e-126 U-box domain-containing protein kinase family protein (.1)
Potri.002G160300 59 / 5e-10 AT2G45910 559 / 0.0 U-box domain-containing protein kinase family protein (.1)
Potri.004G233000 58 / 1e-09 AT4G25160 874 / 0.0 U-box domain-containing protein kinase family protein (.1)
Potri.001G239100 57 / 2e-09 AT2G45910 473 / 6e-156 U-box domain-containing protein kinase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019487 184 / 5e-58 AT5G47740 128 / 3e-36 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10043338 183 / 1e-57 AT5G47740 128 / 2e-36 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10029567 117 / 1e-30 AT5G47740 187 / 4e-57 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10002238 114 / 5e-30 AT5G47740 183 / 2e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10014772 67 / 1e-12 AT3G49060 901 / 0.0 U-box domain-containing protein kinase family protein (.1.2)
Lus10036362 66 / 6e-12 AT3G49060 895 / 0.0 U-box domain-containing protein kinase family protein (.1.2)
Lus10040825 61 / 1e-10 AT2G45910 496 / 1e-163 U-box domain-containing protein kinase family protein (.1)
Lus10016557 58 / 2e-09 AT2G45910 508 / 3e-168 U-box domain-containing protein kinase family protein (.1)
Lus10036359 48 / 4e-06 AT2G45910 598 / 0.0 U-box domain-containing protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Potri.015G083100.1 pacid=42775659 polypeptide=Potri.015G083100.1.p locus=Potri.015G083100 ID=Potri.015G083100.1.v4.1 annot-version=v4.1
ATGGAAGAAGAGAAATATGTGCCGGCAAGTTCTATGCGGTACAGTGCACGAATCATGTCGCCAGAAATCGTAGAGATAGGGGATGATAGCAAGACTATTA
CTAACAGCATAGATGGAATCAATGATGATGTTTATGTAGCTGTTGGTAAAAATGACACTGATGTACTGAAGTGGGCTCTAGATCATGCTGTTTCACCTGG
AGCTCGAGTTTTTCTTGTCCATGTTTTTCCTCCTCTGTCATATATCCCTACACCAGTTGGAAGGTTATCAAGGAGCCAATTAAGTCAAGATCAAGTGAGA
TTTTACATTAATGAAGAGAATAACAGAAGGAGGAACCAGCTGCAAAAATACATTCGCCTGTGTGCCAATGCCAAGGTGACAGTAGATACAATGCTGCTGG
AGAGCAATCTGACTGCCAAAACTATTCTAGAACTCATTCCTGTTCTCAACATCACCCACCTTGTCATGGGAAACAAACGCCTACCTCGCTCAAGGCTGCT
AAGGAAAAAGTTGGGAAAAGGAGAATTTGTGAAGAAGAAAGCTCCAGACTATTGTGAGGTTAGTATTATTCATAATGGAAAGAAGATCATGGATGGTAAG
GATGGGATAGAGCCAGTGTCATCCTGTGCCCGAAGACCAGATGTTATCCGCAGCTCTGCTAACAAGTTTTTCAACCTTCCATGTTTCCCAGTTTGTAGGA
ACATGGTGATGGATTCTTAA
AA sequence
>Potri.015G083100.1 pacid=42775659 polypeptide=Potri.015G083100.1.p locus=Potri.015G083100 ID=Potri.015G083100.1.v4.1 annot-version=v4.1
MEEEKYVPASSMRYSARIMSPEIVEIGDDSKTITNSIDGINDDVYVAVGKNDTDVLKWALDHAVSPGARVFLVHVFPPLSYIPTPVGRLSRSQLSQDQVR
FYINEENNRRRNQLQKYIRLCANAKVTVDTMLLESNLTAKTILELIPVLNITHLVMGNKRLPRSRLLRKKLGKGEFVKKKAPDYCEVSIIHNGKKIMDGK
DGIEPVSSCARRPDVIRSSANKFFNLPCFPVCRNMVMDS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G47740 Adenine nucleotide alpha hydro... Potri.015G083100 0 1
AT2G29970 Double Clp-N motif-containing ... Potri.001G252500 2.44 0.8399
AT3G12920 BRG3 BOI-related gene 3, SBP (S-rib... Potri.001G439600 7.34 0.8592
AT5G64840 ABCF5, ATGCN5 ATP-binding cassette F5, gener... Potri.005G084800 9.79 0.8561 GCN2.2
AT1G10790 unknown protein Potri.001G210600 22.09 0.8042
AT2G39940 COI1 CORONATINE INSENSITIVE 1, RNI-... Potri.008G064400 29.29 0.8343 COI1.2
AT4G36710 GRAS AtHAM4 Arabidopsis thaliana HAIRY MER... Potri.007G029200 33.15 0.8393
AT1G36370 SHM7 serine hydroxymethyltransferas... Potri.001G212000 33.31 0.8186 SHMT9
AT3G27010 TCP ATTCP20, PCF1, ... ARABIDOPSIS THALIANA TEOSINTE ... Potri.017G068748 34.17 0.7365
AT4G34740 CIA1, ATASE2, A... CHLOROPLAST IMPORT APPARATUS 1... Potri.009G125600 36.74 0.8408
AT3G01470 HD HD-ZIP-1, HAT5,... HOMEODOMAIN PROTEIN FROM ARABI... Potri.012G070900 42.96 0.8305

Potri.015G083100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.