Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48240 152 / 2e-47 Octicosapeptide/Phox/Bem1p family protein (.1) AT5G63130 146 / 1e-44 Octicosapeptide/Phox/Bem1p family protein (.1) AT3G26510 118 / 1e-33 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) AT1G70640 112 / 2e-31 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1) AT3G46920 97 / 1e-23 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1) AT5G49920 94 / 1e-23 Octicosapeptide/Phox/Bem1p family protein (.1) AT5G57610 95 / 5e-23 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1) AT4G05150 87 / 2e-20 Octicosapeptide/Phox/Bem1p family protein (.1) AT5G09620 87 / 3e-20 Octicosapeptide/Phox/Bem1p family protein (.1) AT2G01190 87 / 4e-20 PDE331 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G085000 [exp] 277 / 1e-96 AT5G63130 139 / 4e-42 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.008G186500 [exp] 130 / 2e-38 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Potri.010G046400 [exp] 121 / 1e-34 AT3G26510 152 / 5e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Potri.003G006200 [exp] 96 / 3e-24 AT5G49920 188 / 3e-58 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.004G032200 [exp] 94 / 1e-22 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.006G190200 [exp] 94 / 2e-22 AT3G46920 652 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1) Potri.004G224500 [exp] 91 / 4e-22 AT5G49920 185 / 3e-56 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.011G041100 [exp] 91 / 7e-22 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.001G285800 [exp] 91 / 2e-21 AT5G64430 270 / 8e-85 Octicosapeptide/Phox/Bem1p family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043341 [exp] 161 / 1e-50 AT3G48240 145 / 2e-44 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10019490 [exp] 158 / 3e-49 AT3G48240 149 / 9e-46 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10002938 [exp] 139 / 4e-42 AT3G48240 130 / 1e-38 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10026700 [exp] 120 / 2e-34 AT3G26510 135 / 3e-40 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Lus10017947 [exp] 114 / 6e-33 AT5G63130 121 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10006214 [exp] 100 / 1e-26 AT3G26510 123 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Lus10036862 [exp] 99 / 2e-26 AT3G26510 122 / 3e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Lus10002588 [exp] 101 / 2e-25 AT4G05150 319 / 2e-104 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10035641 [exp] 92 / 3e-23 AT5G09620 243 / 6e-78 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10040006 [exp] 96 / 5e-23 AT3G46920 604 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF00564 [poplar] [flax] PB1 PB1 domain
Representative CDS sequence Show only first row Show all	>Potri.015G083400.1 pacid=42775674 polypeptide=Potri.015G083400.1.p locus=Potri.015G083400 ID=Potri.015G083400.1.v4.1 annot-version=v4.1 ATGGTGATGATTGACAATAAAGCAAAAGCAGAAACTCTCAAGTTTCTATGTAGTTACAGCGGGAAATTGCTTCCTCGTTCCAGTGACGGCGTTCTCCGTT ACGTCGGTGGAATGACCAGAGTTCTTGCCGTCGATCGTTCTATATCCTATGCAGAGTTGATGGTGAAGCTAGGTGAATTCTGTGGATTTTCGGTGGAATT AAGGTGTCCTTTACCAAACGGAGACTTGGAGACATTGATTTCGGTAAAATCGGACGAGGAATTAACCAACTTGATTACCGAATACGATAGATCTTGTCCG GGTTCCAAGATTAGAGCTATATTGTTTCCTCCGAAATCGCTCAAGAAAATCTCTCCTCCGACCTCGAATGCTTCCAGCATCGAGTTTTCACCTACCAAAT CAGTTTTGAATCATGACCGATCTGGCAGTTTTTCCCCTCCGATCGGATACAAAGGCCGTCGCTGCAGTCCAAGCCGTCCACAAGAACTCCTACGTCATAA TCATCAGTGTTGCGGTTATTGGCACTAG
AA sequence Show only first row Show all	>Potri.015G083400.1 pacid=42775674 polypeptide=Potri.015G083400.1.p locus=Potri.015G083400 ID=Potri.015G083400.1.v4.1 annot-version=v4.1 MVMIDNKAKAETLKFLCSYSGKLLPRSSDGVLRYVGGMTRVLAVDRSISYAELMVKLGEFCGFSVELRCPLPNGDLETLISVKSDEELTNLITEYDRSCP GSKIRAILFPPKSLKKISPPTSNASSIEFSPTKSVLNHDRSGSFSPPIGYKGRRCSPSRPQELLRHNHQCCGYWH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G48240			Octicosapeptide/Phox/Bem1p fam...		Potri.015G083400 [exp]	0	1
AT4G04885		PCFS4	PCF11P-similar protein 4 (.1)		Potri.007G134000 [exp]	5.65	0.7735
					Potri.009G091700 [exp]	6.63	0.6845
AT5G59740			UDP-N-acetylglucosamine (UAA) ...		Potri.001G234800 [exp]	8.66	0.6512
AT1G78610		MSL6	mechanosensitive channel of sm...		Potri.011G105500 [exp]	11.18	0.6985
AT5G35330		MBD2, MBD02, AT...	METHYL-CPG-BINDING DOMAIN PROT...		Potri.006G077600 [exp]	12.84	0.6405	MBD902
AT4G27280			Calcium-binding EF-hand family...		Potri.001G412077 [exp]	13.41	0.7138
AT3G23750			Leucine-rich repeat protein ki...		Potri.013G035900 [exp]	18.16	0.6712
					Potri.013G152300 [exp]	20.14	0.6792
AT5G54165			unknown protein		Potri.015G004800 [exp]	20.39	0.6509
AT4G27280			Calcium-binding EF-hand family...		Potri.011G129100 [exp]	23.02	0.6863

Compare expression of checked genes

Potri.015G083400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.