Potri.015G085232 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24730 177 / 7e-56 Calcineurin-like metallo-phosphoesterase superfamily protein (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G089400 242 / 4e-81 AT4G24730 440 / 2e-156 Calcineurin-like metallo-phosphoesterase superfamily protein (.1.2.3.4)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019465 176 / 2e-55 AT4G24730 443 / 6e-158 Calcineurin-like metallo-phosphoesterase superfamily protein (.1.2.3.4)
Lus10043315 174 / 9e-55 AT4G24730 373 / 3e-130 Calcineurin-like metallo-phosphoesterase superfamily protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0163 Calcineurin PF00149 Metallophos Calcineurin-like phosphoesterase
Representative CDS sequence
>Potri.015G085232.2 pacid=42775199 polypeptide=Potri.015G085232.2.p locus=Potri.015G085232 ID=Potri.015G085232.2.v4.1 annot-version=v4.1
ATGGGATCAACAATTGTATTGGTAAGCTCACCTGGGAAGCAACCTCTTTTCTCATTTGGTGTAATCTCTGATGTCCAGTATGCTGACATTCCTGATGGTC
ATTCATTCATTGTTGTTCCCCGGTATTATCGATATAGCATTCGTGTACTGCAAAGGGCAGTAAAAAAGTGGAATAACCACCAGAATCTTAACTTTGTGAT
CAACTTCGGGGATATTGTGGATGGGAAATGTCCGCCGGACCAGTCTCTAGATGTTGTAAAGAAAGTAAATAATGAATTTCAGAAATTCAATGGTCCTGTT
TTTCACTTGATCGGCAATCACTGCCTCTATAATCTTCCCCGTGACAAATTACTACCATTGTTGAAGATTCCAGGTCTCAATGGCCATGCCTACTATGATT
TTTTCACCTGGTCCAGAGCACAGAATAGTCGTACTGGATGGCTATGA
AA sequence
>Potri.015G085232.2 pacid=42775199 polypeptide=Potri.015G085232.2.p locus=Potri.015G085232 ID=Potri.015G085232.2.v4.1 annot-version=v4.1
MGSTIVLVSSPGKQPLFSFGVISDVQYADIPDGHSFIVVPRYYRYSIRVLQRAVKKWNNHQNLNFVINFGDIVDGKCPPDQSLDVVKKVNNEFQKFNGPV
FHLIGNHCLYNLPRDKLLPLLKIPGLNGHAYYDFFTWSRAQNSRTGWL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G24730 Calcineurin-like metallo-phosp... Potri.015G085232 0 1
AT2G16405 Transducin/WD40 repeat-like su... Potri.009G121100 7.74 0.7613
AT3G52120 SWAP (Suppressor-of-White-APri... Potri.009G064600 20.49 0.8288
AT2G35060 KUP11 K+ uptake permease 11, K+ upta... Potri.001G123700 25.15 0.8143 Pt-KUP10.1
AT1G25350 OVA9 ovule abortion 9, glutamine-tR... Potri.010G122932 38.47 0.7845
AT5G44280 ATRING1A ARABIDOPSIS THALIANA RING 1A, ... Potri.004G047000 46.09 0.7609
AT1G28120 unknown protein Potri.001G067400 46.18 0.7739
AT3G50810 Uncharacterised protein family... Potri.004G149332 55.39 0.7707
AT1G45150 unknown protein Potri.014G180700 60.97 0.7548
AT3G04490 unknown protein Potri.019G019100 77.30 0.7530
AT1G53490 RING/U-box superfamily protein... Potri.001G383900 118.26 0.7152

Potri.015G085232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.