Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23180 373 / 1e-125 CYP96A1 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) AT4G39490 345 / 2e-114 CYP96A10 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) AT5G52320 337 / 1e-111 CYP96A4 "cytochrome P450, family 96, subfamily A, polypeptide 4", cytochrome P450, family 96, subfamily A, polypeptide 4 (.1) AT4G39480 337 / 2e-111 CYP96A9 "cytochrome P450, family 96, subfamily A, polypeptide 9", cytochrome P450, family 96, subfamily A, polypeptide 9 (.1) AT2G21910 336 / 3e-111 CYP96A5 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) AT1G65340 328 / 2e-108 CYP96A3 "cytochrome P450, family 96, subfamily A, polypeptide 3", cytochrome P450, family 96, subfamily A, polypeptide 3 (.1) AT1G47620 326 / 3e-107 CYP96A8 "cytochrome P450, family 96, subfamily A, polypeptide 8", cytochrome P450, family 96, subfamily A, polypeptide 8 (.1) AT1G57750 325 / 5e-107 MAH1, CYP96A15 MID-CHAIN ALKANE HYDROXYLASE 1, "cytochrome P450, family 96, subfamily A, polypeptide 15", cytochrome P450, family 96, subfamily A, polypeptide 15 (.1.2) AT4G39500 322 / 4e-106 CYP96A11 "cytochrome P450, family 96, subfamily A, polypeptide 11", cytochrome P450, family 96, subfamily A, polypeptide 11 (.1) AT4G32170 320 / 5e-105 CYP96A2 "cytochrome P450, family 96, subfamily A, polypeptide 2", cytochrome P450, family 96, subfamily A, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G086900 [exp] 536 / 0 AT2G23180 455 / 2e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Potri.001G397900 [exp] 437 / 1e-150 AT4G39490 480 / 6e-166 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.005G064400 [exp] 434 / 2e-149 AT4G39490 477 / 8e-165 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.007G080300 [exp] 414 / 2e-141 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.015G132800 [exp] 397 / 4e-135 AT4G39490 589 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.008G125300 [exp] 301 / 5e-98 AT4G39490 410 / 4e-139 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.005G094500 [exp] 295 / 3e-95 AT1G47620 372 / 7e-124 "cytochrome P450, family 96, subfamily A, polypeptide 8", cytochrome P450, family 96, subfamily A, polypeptide 8 (.1) Potri.007G072100 [exp] 281 / 2e-89 AT5G23190 799 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.005G092200 [exp] 281 / 4e-89 AT5G23190 788 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022277 [exp] 392 / 5e-133 AT4G39490 395 / 1e-132 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10022279 [exp] 379 / 5e-128 AT2G23180 449 / 4e-154 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10002527 [exp] 376 / 9e-127 AT2G23180 454 / 7e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10002525 [exp] 375 / 4e-126 AT4G39490 410 / 2e-138 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10003669 [exp] 374 / 5e-126 AT2G23180 440 / 4e-150 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10025677 [exp] 353 / 5e-118 AT2G23180 361 / 1e-119 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10028047 [exp] 351 / 3e-117 AT2G21910 375 / 1e-125 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) Lus10025678 [exp] 343 / 2e-114 AT4G39490 363 / 9e-121 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10035234 [exp] 333 / 9e-110 AT4G39490 382 / 1e-127 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10015306 [exp] 341 / 3e-109 AT4G39490 342 / 3e-108 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.015G087000.1 pacid=42776331 polypeptide=Potri.015G087000.1.p locus=Potri.015G087000 ID=Potri.015G087000.1.v4.1 annot-version=v4.1 ATGTTTCCAGGGCTTTTACTCAATGCATCTCGAGCCCACGAGTTTGCGACTGATCTTCTTCAAAAAAATGATGGCACATTCGTTTTCAAAGGACCTTGGT TTGCTGGCTTCGACTTCATGATCACCAGTAATTCCATGAATGTTCAGCACATTTTGAGCAAAAACTTCACCAACTACCACAGAAACCTCGAGTTCAAGCA GATTTTTGAACCGTTGGGTGATGGGATTTTCAATTCTGACGGAGATTGGTGGAAAACCCAAAGAAGAATAATTCACACTTCGCTTAAGCATAGAAAATTT GAGCTCGCTCTCGAGAAAATCATTCAACAAAAAATCTTGCAAGGACTATTCATGGTTCTTGATCATGTCTCAGTCCTTGGAGTTGAAGTGGATTTACAAG ACGTGTTGCATCGATTAACTTTCGACAACGCCCGCGCCTTGGTATTGGGATTTGATCCAAATTGTCTTTCAATCGATTTCCCTCAAGTTCCATACGAGAA GGCTTATGATGTTATAGAGGAGGTTGCGTTTCATCGGCATCTTAAGCCACATGGCTTTTGGAAGCTACAAAAATGGCTTCAAATTGGACAAGAGAGGAAG ATGAAAAAGGCTTGGGAGATCATTGATCATTTCTTGTGCCAACGCATTTCAAGAAAGCGAGAGTTATTAAGCGAAAGCAAAATCCAAATAGAAGGAGAAG ATCACTTCGACTTATTAACATATATTTTGGTCGAAGATGATGATAAAGGAGGAGAAAAGGGTGTCTTCAGAAAATCAGATAAATTTGTGAGAGACATGGC TTTTTACCTTTTGGCAGCAGGGAGTGATACTGTAGCTTCCGGCCTCGTTTGGTTTTTGTGGCTTGTGTCGACACACCCATTAGTAGAAATGAAGATTTTA GAAGAAATAAAAGCAAATTTAAGTGTAGAAGGAGAAGAGAAGTGGAGGTTTTTCAATTTTAAAGAGCTAAGTAAACTAGTTTATCTTCATGCAGCTATAT GTGAGGCCCTTAGGCTGTATCCACCCGTTCCTTTCGAACACAAAGATTCAATCGAATCAGAGATTCTTCCAAGTGGGCATCATATTGGTAGAAATACAAG GATCATATATTCTCTTTACTCAATGGGAAGGATGAAAGAAATATGGGGTGAAGATTGCCTAGAATTCAAGCCGGAAAGGTGGATTTCAGACCAAGGACAA ATCAAACCTGTTTCCCCTTACAAGTTCATAGTTTCAATGCAGGACCGAGGACTTGTTTAG
AA sequence Show only first row Show all	>Potri.015G087000.1 pacid=42776331 polypeptide=Potri.015G087000.1.p locus=Potri.015G087000 ID=Potri.015G087000.1.v4.1 annot-version=v4.1 MFPGLLLNASRAHEFATDLLQKNDGTFVFKGPWFAGFDFMITSNSMNVQHILSKNFTNYHRNLEFKQIFEPLGDGIFNSDGDWWKTQRRIIHTSLKHRKF ELALEKIIQQKILQGLFMVLDHVSVLGVEVDLQDVLHRLTFDNARALVLGFDPNCLSIDFPQVPYEKAYDVIEEVAFHRHLKPHGFWKLQKWLQIGQERK MKKAWEIIDHFLCQRISRKRELLSESKIQIEGEDHFDLLTYILVEDDDKGGEKGVFRKSDKFVRDMAFYLLAAGSDTVASGLVWFLWLVSTHPLVEMKIL EEIKANLSVEGEEKWRFFNFKELSKLVYLHAAICEALRLYPPVPFEHKDSIESEILPSGHHIGRNTRIIYSLYSMGRMKEIWGEDCLEFKPERWISDQGQ IKPVSPYKFIVSMQDRGLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G23180		CYP96A1	"cytochrome P450, family 96, s...		Potri.015G087000 [exp]	0	1
AT3G03630		CS26	cysteine synthase 26 (.1)		Potri.019G045800 [exp]	10.19	0.9162
AT5G66520			Tetratricopeptide repeat (TPR)...		Potri.004G237000 [exp]	10.95	0.9161
AT3G06730		TRXz, TRXP ,TRX...	thioredoxin putative plastidic...		Potri.001G028500 [exp]	16.52	0.9130
AT4G24175			unknown protein		Potri.005G240800 [exp]	16.61	0.9114
AT1G17870		ATEGY3	ethylene-dependent gravitropis...		Potri.001G289700 [exp]	17.32	0.8833
AT4G01650			Polyketide cyclase / dehydrase...		Potri.014G110600 [exp]	21.56	0.9063
AT1G14730			Cytochrome b561/ferric reducta...		Potri.008G138300 [exp]	23.36	0.8598
AT2G44920			Tetratricopeptide repeat (TPR)...		Potri.008G058800 [exp]	24.97	0.8986
AT1G27760		SAT32, ATSAT32	SALT-TOLERANCE 32, interferon-...		Potri.009G088700 [exp]	28.24	0.8815
AT3G11570		TBL8	TRICHOME BIREFRINGENCE-LIKE 8 ...		Potri.016G074800 [exp]	32.09	0.8850

Compare expression of checked genes

Potri.015G087000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.