Potri.015G087301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67785 91 / 3e-26 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018082 102 / 8e-31 AT1G67785 100 / 3e-30 unknown protein
Lus10042077 61 / 1e-14 AT1G67785 67 / 4e-17 unknown protein
PFAM info
Representative CDS sequence
>Potri.015G087301.1 pacid=42775694 polypeptide=Potri.015G087301.1.p locus=Potri.015G087301 ID=Potri.015G087301.1.v4.1 annot-version=v4.1
ATGGTGAAAGTAGCCGGCTTTTTCGCCATGTCAGTGGGAGCCTTTATATTTTGGCAAACTATGGACAAAATCCATGTCTGGAATGCTCTTCGCCAGGATG
AGAAGCAAGAAAGATTTGAAAAGGAGATGGAGATCAAGAGGGTTAGAGAAGAGTTATTGCGACAAGCTAAAGATAAGGATGCTCTCGCATGA
AA sequence
>Potri.015G087301.1 pacid=42775694 polypeptide=Potri.015G087301.1.p locus=Potri.015G087301 ID=Potri.015G087301.1.v4.1 annot-version=v4.1
MVKVAGFFAMSVGAFIFWQTMDKIHVWNALRQDEKQERFEKEMEIKRVREELLRQAKDKDALA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67785 unknown protein Potri.015G087301 0 1
AT2G47320 Cyclophilin-like peptidyl-prol... Potri.002G194250 3.16 0.9206
AT5G50460 secE/sec61-gamma protein trans... Potri.001G329400 3.60 0.9272
AT3G13845 unknown protein Potri.003G037100 5.29 0.8696
AT1G05720 selenoprotein family protein (... Potri.013G126900 5.91 0.8650
AT5G67590 FRO1 FROSTBITE1, NADH-ubiquinone ox... Potri.007G005100 6.48 0.9006
AT3G03070 NADH-ubiquinone oxidoreductase... Potri.013G082100 6.48 0.8807
AT1G72020 unknown protein Potri.019G081700 7.21 0.9045
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Potri.008G155500 8.48 0.9023 Pt-PBD2.3
AT1G19910 AVA-2PE, ATVHA-... VACUOLAR-TYPE H+ ATPASE C2, AT... Potri.005G235300 10.00 0.9033
AT2G25310 Protein of unknown function (D... Potri.018G024600 13.41 0.8578

Potri.015G087301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.