Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-CYSP2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50260 550 / 0 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) AT3G48350 499 / 3e-178 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1) AT3G48340 497 / 2e-177 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1) AT1G20850 367 / 3e-126 XCP2 xylem cysteine peptidase 2 (.1) AT4G35350 357 / 1e-122 XCP1 xylem cysteine peptidase 1 (.1.2) AT5G43060 356 / 1e-120 Granulin repeat cysteine protease family protein (.1) AT1G47128 354 / 9e-120 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) AT4G36880 345 / 1e-117 CP1 cysteine proteinase1 (.1) AT5G45890 344 / 2e-117 SAG12 senescence-associated gene 12 (.1) AT3G19390 345 / 2e-116 Granulin repeat cysteine protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G090900 [exp] 663 / 0 AT5G50260 561 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Potri.015G087500 [exp] 619 / 0 AT5G50260 530 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Potri.008G183100 [exp] 499 / 2e-178 AT5G50260 489 / 2e-174 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Potri.013G118200 [exp] 379 / 1e-131 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1) Potri.013G126100 [exp] 377 / 2e-130 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1) Potri.011G064900 [exp] 374 / 3e-129 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1) Potri.009G098100 [exp] 377 / 8e-129 AT1G47128 607 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Potri.013G118400 [exp] 368 / 5e-127 AT5G45890 378 / 2e-131 senescence-associated gene 12 (.1) Potri.005G088600 [exp] 368 / 1e-126 AT5G45890 406 / 8e-142 senescence-associated gene 12 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013674 [exp] 580 / 0 AT5G50260 554 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10033040 [exp] 580 / 0 AT5G50260 555 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10042078 [exp] 575 / 0 AT5G50260 538 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10018083 [exp] 574 / 0 AT5G50260 533 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10014087 [exp] 380 / 7e-130 AT5G43060 622 / 0.0 Granulin repeat cysteine protease family protein (.1) Lus10020723 [exp] 373 / 5e-129 AT5G45890 398 / 3e-139 senescence-associated gene 12 (.1) Lus10006542 [exp] 372 / 2e-128 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1) Lus10003275 [exp] 371 / 5e-128 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1) Lus10026362 [exp] 371 / 5e-128 AT5G45890 396 / 2e-138 senescence-associated gene 12 (.1) Lus10020730 [exp] 371 / 6e-128 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF00112 [poplar] [flax] Peptidase_C1 Papain family cysteine protease CL0125 [poplar] [flax] PF08246 [poplar] [flax] Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Representative CDS sequence Show only first row Show all	>Potri.015G087400.1 pacid=42775028 polypeptide=Potri.015G087400.1.p locus=Potri.015G087400 ID=Potri.015G087400.1.v4.1 annot-version=v4.1 ATGGAAATGAAGAAATTCTTATTTGTTGCTCTTTCTTTAGCCTTGGTTTTAGGAATCACTGAAAGTTTGGATTTTCATGAAAAAGATTTGGAATCTGAGG AAAGTTTGTGGGATTTGTATGAGAGATGGAGGAGCCATCATACCGTTTCAACAAGTCTTGATGAGAAACACAAACGTTTCAATGTGTTCAAGGAAAATGT TATGCATGTTCACAAAACTAACAAGATGGGTAAGCCCTATAAGTTGAAATTGAACAAGTTTGCAGACATGACTAACCATGAATTCAGGTCTGTATATGCT GGATCAAAGGTTAAACATCATAGGATGTTTCGTGGGACAACACGAGGAAATGGGAGCTTCATGTATGGGAAGGTAGAAAAGGTCCCCACATCTGTTGACT GGAGGAAGAAGGGCGCTGTGACTGCTGTTAAGGACCAAGGTCAATGTGGAAGTTGCTGGGCGTTTTCAACCATAGTTGCAGTTGAGGGTATTAATTATAT TAAGACAAATGAGCTAGTATCTTTGTCTGAGCAAGAGTTGGTGGATTGTGACACTACAGAAAATCAAGGATGTAATGGAGGGCTAATGGAATATGCTTTT GAGTTCATTAAGAAAAAGAGAGGCATAACAACAGAGTCTACTTACCCTTATAAAGCTGAAGATGGACATTGTGATGCTGCAAAGGAAAACAACCCGGCAG TGTCTATTGATGGGTATGAGAAAGTTCCTGAAAATGATGAGGATGCATTACTGAAAGCTGCTGCAAACCAACCAGTATCTGTAGCCATAGATGCTGGGGG TTCAGATTTCCAGTTCTACTCCGAGGGTGTCTTTATTGGAGAGTGCGGAACCGAGCTGGATCATGGAGTGGCAGTTGTGGGCTATGGAACAACTCTTGAT GGAACTAAGTACTGGATTGTTAGAAATTCCTGGGGACCTGAATGGGGAGAGAAAGGTTACATCAGGATGCAGCGAGGCATCTCTGACAAGGAAGGACTCT GTGGTATTGCAATGGAGGCTTCATATCCTATCAAAAACTCCTCAACTAATCCTTCAGGAACCAAATCTTCCCCCAAGGATGAACTCTAA
AA sequence Show only first row Show all	>Potri.015G087400.1 pacid=42775028 polypeptide=Potri.015G087400.1.p locus=Potri.015G087400 ID=Potri.015G087400.1.v4.1 annot-version=v4.1 MEMKKFLFVALSLALVLGITESLDFHEKDLESEESLWDLYERWRSHHTVSTSLDEKHKRFNVFKENVMHVHKTNKMGKPYKLKLNKFADMTNHEFRSVYA GSKVKHHRMFRGTTRGNGSFMYGKVEKVPTSVDWRKKGAVTAVKDQGQCGSCWAFSTIVAVEGINYIKTNELVSLSEQELVDCDTTENQGCNGGLMEYAF EFIKKKRGITTESTYPYKAEDGHCDAAKENNPAVSIDGYEKVPENDEDALLKAAANQPVSVAIDAGGSDFQFYSEGVFIGECGTELDHGVAVVGYGTTLD GTKYWIVRNSWGPEWGEKGYIRMQRGISDKEGLCGIAMEASYPIKNSSTNPSGTKSSPKDEL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Potri.015G087400 [exp]	0	1	Pt-CYSP2.1
AT3G15510	NAC	ATNAC2, ANAC056...	NAC-REGULATED SEED MORPHOLOGY ...		Potri.001G404400 [exp]	1.41	0.9436	Pt-ATNAC2.2
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Potri.015G087500 [exp]	1.73	0.9525
AT2G14095			unknown protein		Potri.017G050000 [exp]	3.46	0.9342
AT1G20970			unknown protein		Potri.016G047500 [exp]	4.47	0.9227
					Potri.009G135000 [exp]	4.89	0.9070
AT3G26590			MATE efflux family protein (.1...		Potri.008G187100 [exp]	6.24	0.8931
AT4G28500	NAC	ANAC073, SND2, ...	SECONDARY WALL-ASSOCIATED NAC ...		Potri.004G049300 [exp]	6.48	0.8904
AT5G12950			Putative glycosyl hydrolase of...		Potri.001G018200 [exp]	6.70	0.8805
AT2G46550			unknown protein		Potri.005G071400 [exp]	7.48	0.9077
AT1G52330			Late embryogenesis abundant (L...		Potri.001G180600 [exp]	9.48	0.8986

Compare expression of checked genes

Potri.015G087400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.