Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01820 227 / 3e-74 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G37250 128 / 2e-35 ADK, ATPADK1 adenosine kinase (.1) AT2G39270 121 / 1e-32 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G50370 61 / 1e-10 Adenylate kinase family protein (.1) AT5G63400 59 / 2e-10 ADK1 adenylate kinase 1 (.1.2) AT5G35170 50 / 8e-07 adenylate kinase family protein (.1.2) AT3G60180 48 / 2e-06 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT4G25280 46 / 9e-06 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G26667 44 / 4e-05 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) AT3G60961 41 / 0.0001 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G333100 [exp] 235 / 3e-77 AT3G01820 249 / 8e-83 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G095700 [exp] 170 / 7e-54 AT3G01820 90 / 8e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.010G215300 [exp] 137 / 5e-39 AT2G37250 382 / 2e-134 adenosine kinase (.1) Potri.008G046100 [exp] 132 / 6e-37 AT2G37250 377 / 1e-132 adenosine kinase (.1) Potri.012G095300 [exp] 53 / 5e-08 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2) Potri.015G129000 [exp] 50 / 3e-07 AT4G25280 301 / 6e-104 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.018G113400 [exp] 50 / 7e-07 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2) Potri.015G092800 [exp] 49 / 9e-07 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2) Potri.006G189201 [exp] 44 / 1e-05 AT5G35170 158 / 1e-46 adenylate kinase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032057 [exp] 244 / 7e-81 AT3G01820 244 / 5e-81 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10035224 [exp] 241 / 1e-79 AT3G01820 242 / 3e-80 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022342 [exp] 228 / 3e-74 AT3G01820 255 / 4e-85 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10040358 [exp] 138 / 3e-39 AT2G37250 405 / 1e-143 adenosine kinase (.1) Lus10023476 [exp] 134 / 9e-38 AT2G37250 407 / 2e-144 adenosine kinase (.1) Lus10001984 [exp] 133 / 2e-37 AT2G37250 391 / 4e-138 adenosine kinase (.1) Lus10030296 [exp] 131 / 1e-36 AT2G37250 395 / 1e-139 adenosine kinase (.1) Lus10016757 [exp] 54 / 3e-08 AT5G63400 416 / 2e-149 adenylate kinase 1 (.1.2) Lus10022453 [exp] 53 / 5e-08 AT5G63400 411 / 2e-147 adenylate kinase 1 (.1.2) Lus10031714 [exp] 51 / 6e-07 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00406 [poplar] [flax] ADK Adenylate kinase
Representative CDS sequence Show only first row Show all	>Potri.015G093200.1 pacid=42776129 polypeptide=Potri.015G093200.1.p locus=Potri.015G093200 ID=Potri.015G093200.1.v4.1 annot-version=v4.1 ATGATCGCGCTGAGCCGCCATTCCTCCACCGCAAAAGCGGCTGTACCGGCTGTTTACCGTCTGTTTAACATCACTTGGAGCAGGTTCTTCAGCACTGCAG GTGCAGCAGCAGAGGCGCAGCTGGACCCCGACTACTACTACTACAACGAGCCGCCCCGACGCAACCCACTTGGCGCCATGGATGACACAGAAAATTCGGT TCCAGGAAGAGGAGTGCAGTGGGCGTTTATAGGAAGCCCACGCGCGAAGAAGCGCGTGTATGCTGAGACTCTCTCGAAGCTTCTGGAAGTACCTTGCATT TCCATGGCTAGTCTCGCTCGCCAAGAACTTAACCCTCGCTCTTCTCTGTATAAACAGATTGCAAATGCTGTGAATCGTAGGATGCTTGTTCCAGAGGATA TAATTTTTGGCCTGTTATCAAAGAGGTTGGAAGATGGGTATTACAAAGGTGAAACTGGTTTTATTCTGGATGGAATTCCTCGTTCACGGTTACAAGCTGA GATTCTTGATCAACTTGTGGAGATTGATTTGGTCGTGAATTTTAGGTGCACTGATGATTCCTTGGTGAAACACCAAGAAGAAGGTATCTGGAAAGAGAGA GTCTATGCTGAACAGAGCAAGCCACTAGAAGATTATTACCAGAAACAAAAAAGGCTTCTTGACTTTCAAGTAGGCAGTGCACCAGCAGAGAATTGGCAGG GGCTGTTGGCTGCATTGCATCTACAACACATAAATGCTGCGTGCTCGTCAAAGAAACCGACCACATCATCTAGCATGCTCTGA
AA sequence Show only first row Show all	>Potri.015G093200.1 pacid=42776129 polypeptide=Potri.015G093200.1.p locus=Potri.015G093200 ID=Potri.015G093200.1.v4.1 annot-version=v4.1 MIALSRHSSTAKAAVPAVYRLFNITWSRFFSTAGAAAEAQLDPDYYYYNEPPRRNPLGAMDDTENSVPGRGVQWAFIGSPRAKKRVYAETLSKLLEVPCI SMASLARQELNPRSSLYKQIANAVNRRMLVPEDIIFGLLSKRLEDGYYKGETGFILDGIPRSRLQAEILDQLVEIDLVVNFRCTDDSLVKHQEEGIWKER VYAEQSKPLEDYYQKQKRLLDFQVGSAPAENWQGLLAALHLQHINAACSSKKPTTSSSML

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G01820			P-loop containing nucleoside t...		Potri.015G093200 [exp]	0	1
AT1G64720		CP5	Polyketide cyclase/dehydrase a...		Potri.012G021400 [exp]	3.16	0.8350
AT1G78600	CO	BBX22, DBB3, ST...	SALT TOLERANCE HOMOLOG 3, DOUB...		Potri.001G384000 [exp]	4.89	0.7767
					Potri.007G054500 [exp]	6.00	0.8322
AT1G13310			Endosomal targeting BRO1-like ...		Potri.010G128700 [exp]	6.00	0.8100
AT5G49220			Protein of unknown function (D...		Potri.008G213300 [exp]	9.59	0.8221
AT2G46800		ATMTP1, ZAT1, Z...	ZINC TRANSPORTER OF ARABIDOPSI...		Potri.014G106200 [exp]	10.48	0.8036	Pt-MTP1.1
AT5G43500		ATARP9	actin-related protein 9 (.1.2)		Potri.008G165000 [exp]	12.00	0.8026
AT4G19140			unknown protein		Potri.001G130900 [exp]	12.00	0.8158
AT4G14746			unknown protein		Potri.010G082500 [exp]	14.69	0.7689
					Potri.010G111100 [exp]	15.23	0.8128

Compare expression of checked genes

Potri.015G093200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.