RPL17.2 (Potri.015G094400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPL17.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27400 323 / 6e-115 Ribosomal protein L22p/L17e family protein (.1)
AT1G67430 319 / 3e-113 Ribosomal protein L22p/L17e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G096600 362 / 3e-130 AT1G27400 321 / 4e-114 Ribosomal protein L22p/L17e family protein (.1)
Potri.008G175500 332 / 2e-118 AT1G67430 285 / 1e-99 Ribosomal protein L22p/L17e family protein (.1.2)
Potri.010G060400 332 / 2e-118 AT1G67430 299 / 3e-105 Ribosomal protein L22p/L17e family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006421 317 / 3e-112 AT1G67430 315 / 1e-111 Ribosomal protein L22p/L17e family protein (.1.2)
Lus10015792 293 / 2e-94 AT1G67420 511 / 2e-168 Zn-dependent exopeptidases superfamily protein (.1.2)
Lus10037015 291 / 6e-93 AT1G67420 1104 / 0.0 Zn-dependent exopeptidases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e
Representative CDS sequence
>Potri.015G094400.2 pacid=42775717 polypeptide=Potri.015G094400.2.p locus=Potri.015G094400 ID=Potri.015G094400.2.v4.1 annot-version=v4.1
ATGGTGAAGTATTCAAGAGAACCAGATAACCAAACCAAGTCCTGCAAAGCAAGGGGATCTGATCTTCGTGTTCACTTTAAGAACACAAGAGAGACTGCGT
TTTCAATCCGGAAGATGCCTTTGGACAAGGCCAAACGGTACTTGGAGGATGTTTTGGCACACAAGCAAGCTATTCCTTTCCGACGTTTCTGTGGCGGTGT
TGGGCGAACTGCTCAAGCTAAGAACCGCCACTCAAATGGACAAGGACGCTGGCCTGCTAAATCTGCTAAATTTATCCTTGATTTGCTAAAGAACGCTGAA
AGCAATGCTGAGGTGAAAGGTTTGGATGTTGATGCACTTTACATATCACATATCCAAGTCAATCAAGCACAAAAACAGCGTCGCCGTACTTATCGTGCCC
ATGGAAGAATAAACCCTTACATGTCATCGCCATGTCACATCGAGTTAATTTTGTCTGAAAAGGAAGAACCTGTCAAGAAAGAGGCTGATACTCAGATTGC
TCCTAGGAAGCCTAAGGGTGCTCTTCGTAGTGGAGCTTCCTCCTGA
AA sequence
>Potri.015G094400.2 pacid=42775717 polypeptide=Potri.015G094400.2.p locus=Potri.015G094400 ID=Potri.015G094400.2.v4.1 annot-version=v4.1
MVKYSREPDNQTKSCKARGSDLRVHFKNTRETAFSIRKMPLDKAKRYLEDVLAHKQAIPFRRFCGGVGRTAQAKNRHSNGQGRWPAKSAKFILDLLKNAE
SNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEADTQIAPRKPKGALRSGASS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.015G094400 0 1 RPL17.2
AT4G09800 RPS18C S18 ribosomal protein (.1) Potri.005G211200 1.00 0.9861
AT4G14320 Zinc-binding ribosomal protein... Potri.005G092500 1.41 0.9860
AT3G04840 Ribosomal protein S3Ae (.1) Potri.008G156300 1.73 0.9843 RS3.2
AT1G43170 RPL3A, ARP1, EM... embryo defective 2207, ribosom... Potri.005G194500 2.00 0.9841 ARP1.1
AT4G16720 Ribosomal protein L23/L15e fam... Potri.001G156100 2.44 0.9829 RPL15.3
AT5G35530 Ribosomal protein S3 family pr... Potri.006G222100 2.64 0.9812
AT1G77940 Ribosomal protein L7Ae/L30e/S1... Potri.005G080700 3.00 0.9768
AT2G09990 Ribosomal protein S5 domain 2-... Potri.001G304700 3.16 0.9762 RPS16.3
AT3G02560 Ribosomal protein S7e family p... Potri.017G115400 3.16 0.9841
AT3G12390 Nascent polypeptide-associated... Potri.001G034400 3.74 0.9725

Potri.015G094400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.