Potri.015G098200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27030 107 / 7e-31 unknown protein
AT5G40970 96 / 3e-27 Protein of unknown function (DUF 3339) (.1)
AT5G63500 80 / 4e-21 Protein of unknown function (DUF 3339) (.1)
AT3G48660 80 / 7e-21 Protein of unknown function (DUF 3339) (.1)
AT5G14110 79 / 7e-21 Protein of unknown function (DUF 3339) (.1)
AT3G01950 79 / 1e-20 Protein of unknown function (DUF 3339) (.1)
AT3G27027 78 / 2e-20 Protein of unknown function (DUF 3339) (.1)
AT5G08391 77 / 5e-20 Protein of unknown function (DUF 3339) (.1)
AT5G40980 70 / 3e-17 Protein of unknown function (DUF 3339) (.1)
AT3G01940 57 / 5e-12 Protein of unknown function (DUF 3339) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G064500 101 / 1e-29 AT3G27030 111 / 2e-33 unknown protein
Potri.001G328800 100 / 3e-29 AT3G27030 79 / 2e-20 unknown protein
Potri.003G170400 85 / 4e-23 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1)
Potri.003G170500 84 / 1e-22 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1)
Potri.001G057900 82 / 6e-22 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1)
Potri.001G329000 80 / 3e-21 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1)
Potri.017G064301 80 / 6e-21 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1)
Potri.001G328701 81 / 1e-20 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1)
Potri.015G098300 76 / 2e-19 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041551 103 / 2e-30 AT3G27030 113 / 3e-34 unknown protein
Lus10012542 103 / 2e-30 AT3G27030 113 / 3e-34 unknown protein
Lus10035199 102 / 8e-30 AT3G27030 108 / 4e-32 unknown protein
Lus10032030 100 / 4e-29 AT3G27030 106 / 2e-31 unknown protein
Lus10032029 100 / 3e-28 AT3G27027 106 / 4e-30 Protein of unknown function (DUF 3339) (.1)
Lus10037036 84 / 1e-22 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1)
Lus10015769 83 / 3e-22 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1)
Lus10035201 83 / 3e-22 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1)
Lus10032032 83 / 3e-22 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1)
Lus10011353 82 / 6e-22 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11820 DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence
>Potri.015G098200.1 pacid=42776198 polypeptide=Potri.015G098200.1.p locus=Potri.015G098200 ID=Potri.015G098200.1.v4.1 annot-version=v4.1
ATGGCAGTGGAATATAACATCTATAAAGGGTCTTGCAGTGCTGCAGTACCGAAACCAAGAAGAAAATTCTTGTCTGCATTTCTTCAATTGATCTTGAAGG
AGGAGGTCTTTGAGAGAAAGAATCCAACAATGGCAGACTGGGCACCTATATTGCTGGGTTTTGTGCTCTTCATTCTGCTCTCTCCTGGCCTGTTATTCCA
AGTACCCGGGAACACACGAAACCTGGAGTTCAGCAGCTTCACAACCAACGGAAAGGCCATTGTTGTCCACACCCTCATATTCTTCGTTGTCTTTACCATC
CTCATTTTAGCACTGGGCATTCGCATTTACACTGGTTAA
AA sequence
>Potri.015G098200.1 pacid=42776198 polypeptide=Potri.015G098200.1.p locus=Potri.015G098200 ID=Potri.015G098200.1.v4.1 annot-version=v4.1
MAVEYNIYKGSCSAAVPKPRRKFLSAFLQLILKEEVFERKNPTMADWAPILLGFVLFILLSPGLLFQVPGNTRNLEFSSFTTNGKAIVVHTLIFFVVFTI
LILALGIRIYTG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G27030 unknown protein Potri.015G098200 0 1
AT1G68390 Core-2/I-branching beta-1,6-N-... Potri.015G045400 2.82 0.8905
AT5G24560 ATPP2-B12 phloem protein 2-B12 (.1) Potri.015G120300 5.00 0.9294
Potri.017G050200 7.14 0.8464
Potri.013G113800 11.31 0.8333
AT5G53730 Late embryogenesis abundant (L... Potri.015G002400 14.00 0.8582
AT3G61172 LCR8 low-molecular-weight cysteine-... Potri.016G061600 17.23 0.8801
AT5G47530 Auxin-responsive family protei... Potri.007G024700 23.02 0.8716
AT5G22870 Late embryogenesis abundant (L... Potri.009G003800 23.06 0.8787
AT2G37925 COPT4 copper transporter 4 (.1) Potri.006G093300 26.92 0.8787
AT1G14730 Cytochrome b561/ferric reducta... Potri.010G102400 27.82 0.8782

Potri.015G098200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.