Potri.015G098300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48660 107 / 2e-32 Protein of unknown function (DUF 3339) (.1)
AT5G63500 105 / 1e-31 Protein of unknown function (DUF 3339) (.1)
AT5G08391 92 / 2e-26 Protein of unknown function (DUF 3339) (.1)
AT3G27027 91 / 6e-26 Protein of unknown function (DUF 3339) (.1)
AT5G14110 90 / 1e-25 Protein of unknown function (DUF 3339) (.1)
AT3G01950 89 / 3e-25 Protein of unknown function (DUF 3339) (.1)
AT3G27030 86 / 5e-23 unknown protein
AT5G40980 83 / 9e-23 Protein of unknown function (DUF 3339) (.1)
AT5G40970 75 / 2e-19 Protein of unknown function (DUF 3339) (.1)
AT3G01940 63 / 5e-15 Protein of unknown function (DUF 3339) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G170400 111 / 5e-34 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1)
Potri.001G058001 103 / 1e-30 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1)
Potri.001G329000 100 / 9e-30 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1)
Potri.003G170500 98 / 1e-28 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1)
Potri.001G057900 95 / 1e-27 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1)
Potri.001G328701 97 / 2e-27 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1)
Potri.017G064301 95 / 2e-27 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1)
Potri.017G065444 87 / 1e-24 AT3G48660 67 / 2e-16 Protein of unknown function (DUF 3339) (.1)
Potri.012G100100 87 / 2e-24 AT5G63500 79 / 1e-21 Protein of unknown function (DUF 3339) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011353 112 / 3e-34 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1)
Lus10003120 110 / 1e-33 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1)
Lus10015769 106 / 5e-32 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1)
Lus10037036 104 / 2e-31 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1)
Lus10015770 98 / 1e-28 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1)
Lus10037035 97 / 4e-28 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1)
Lus10041550 96 / 5e-27 AT3G27030 122 / 8e-37 unknown protein
Lus10035201 92 / 2e-26 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1)
Lus10032032 92 / 2e-26 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1)
Lus10032028 88 / 1e-24 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11820 DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence
>Potri.015G098300.2 pacid=42775722 polypeptide=Potri.015G098300.2.p locus=Potri.015G098300 ID=Potri.015G098300.2.v4.1 annot-version=v4.1
ATGCTACAAGCAAAATCATCATCTACAGGATCAGTTGGAAATTGGGGGCCAGTGATAGTAGCAGTGGTGCTGTTTGTGCTGTTAACACCGGGGCTGCTGT
TTCAGATACCTGGAAAGAGCAGGGTGGTGGAGTTTGGGAATATGCAGACAAGTGGTGCTTCCATTGCTGTACATGCTATTGTTTTTTCTGGGCTCATCAC
TATCTTCCTTGTTGCCATTGGTGTTCACATCTATGCCGCTAAGTAA
AA sequence
>Potri.015G098300.2 pacid=42775722 polypeptide=Potri.015G098300.2.p locus=Potri.015G098300 ID=Potri.015G098300.2.v4.1 annot-version=v4.1
MLQAKSSSTGSVGNWGPVIVAVVLFVLLTPGLLFQIPGKSRVVEFGNMQTSGASIAVHAIVFSGLITIFLVAIGVHIYAAK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G48660 Protein of unknown function (D... Potri.015G098300 0 1
AT4G18020 GARP APRR2 PSEUDO-RESPONSE REGULATOR 2, C... Potri.003G087700 1.41 0.8819 PtpRR10
Potri.001G410554 4.89 0.8536
AT3G14720 ATMPK19 ARABIDOPSIS THALIANA MAP KINAS... Potri.011G102500 6.32 0.8382 Pt-TDY1.1
AT1G42540 ATGLR3.3 glutamate receptor 3.3 (.1) Potri.002G007400 6.48 0.8284 GLR3.2
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Potri.002G026100 8.36 0.8337
AT5G42785 unknown protein Potri.005G228800 8.48 0.7960
AT1G71870 MATE efflux family protein (.1... Potri.013G115600 8.94 0.8018
AT4G39210 APL3 Glucose-1-phosphate adenylyltr... Potri.009G118800 9.79 0.8129 Pt-APL3.2
AT4G24120 ATYSL1, YSL1 YELLOW STRIPE like 1 (.1) Potri.001G082400 9.94 0.8134
AT2G01430 HD ATHB17, ATHB-17 ARABIDOPSIS THALIANA HOMEOBOX-... Potri.010G112600 11.61 0.7488

Potri.015G098300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.