Potri.015G098500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G01960 37 / 0.0003 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G100300 66 / 9e-16 ND /
Potri.001G328300 40 / 4e-05 AT3G01960 54 / 6e-10 unknown protein
Potri.017G065916 39 / 9e-05 AT3G01960 / unknown protein
Potri.003G169500 37 / 0.0002 ND /
Potri.001G058500 37 / 0.0003 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.015G098500.1 pacid=42776590 polypeptide=Potri.015G098500.1.p locus=Potri.015G098500 ID=Potri.015G098500.1.v4.1 annot-version=v4.1
ATGGAAGCAAACTATAAGCAAAGAGGGTGGTTCAGTACCAGCAGTGTCAAGCTGGTCATGTCTCTGCATCAAGCATCCAATCCATCATCATCTACTGTGC
ATTATGATAGCTCAGTCAATCCGAGCCGATCTTCATCAGTTGCTTCTGTGCGCAGAAAAAATGATGGAAATCTGGATCATCCACATAACATTTATAATGG
TCAAGACAAGTTCCTAACTGGTGATGAAAGCATTGATGCCAGAGCTGCAAGTTACATCTCAAGCGTTCGGCAACGGTTTAGGCTTGAGTGA
AA sequence
>Potri.015G098500.1 pacid=42776590 polypeptide=Potri.015G098500.1.p locus=Potri.015G098500 ID=Potri.015G098500.1.v4.1 annot-version=v4.1
MEANYKQRGWFSTSSVKLVMSLHQASNPSSSTVHYDSSVNPSRSSSVASVRRKNDGNLDHPHNIYNGQDKFLTGDESIDARAASYISSVRQRFRLE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.015G098500 0 1
AT5G13200 GRAM domain family protein (.1... Potri.001G323300 2.44 0.8934
AT1G25400 unknown protein Potri.008G121700 2.44 0.8682
Potri.005G170200 3.00 0.8497
AT1G52360 Coatomer, beta' subunit (.1.2) Potri.006G250200 14.07 0.8037
Potri.005G149001 15.87 0.7680
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Potri.008G189000 18.00 0.7680
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Potri.006G274900 19.74 0.7345
AT5G66580 unknown protein Potri.009G110700 21.21 0.7667
AT3G22370 AtHSR3, ATAOX1A... hyper-sensitivity-related 3, a... Potri.012G001500 22.44 0.7622
AT1G17170 ATGSTU24 Arabidopsis thaliana Glutathio... Potri.011G113400 22.58 0.7516

Potri.015G098500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.