Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50720 167 / 2e-54 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) AT4G24960 162 / 3e-52 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3) AT1G74520 114 / 8e-33 ATHVA22A HVA22 homologue A (.1) AT2G42820 110 / 2e-31 HVA22F HVA22-like protein F (.1) AT5G62490 99 / 5e-27 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) AT1G69700 98 / 2e-26 ATHVA22C HVA22 homologue C (.1) AT4G36720 57 / 2e-10 HVA22K HVA22-like protein K (.1) AT5G42560 55 / 2e-09 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) AT1G75700 52 / 5e-09 HVA22G HVA22-like protein G (.1) AT1G19950 50 / 1e-07 HVA22H HVA22-like protein H (ATHVA22H) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G101600 [exp] 202 / 3e-68 AT5G50720 133 / 3e-41 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.012G069300 [exp] 113 / 1e-32 AT1G74520 259 / 1e-89 HVA22 homologue A (.1) Potri.015G062800 [exp] 112 / 4e-32 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.001G006000 [exp] 109 / 3e-31 AT2G42820 235 / 1e-80 HVA22-like protein F (.1) Potri.014G148600 [exp] 104 / 2e-29 AT5G62490 87 / 1e-22 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) Potri.005G152100 [exp] 76 / 1e-16 AT1G69700 102 / 1e-25 HVA22 homologue C (.1) Potri.001G283000 [exp] 69 / 4e-14 AT1G74520 98 / 1e-23 HVA22 homologue A (.1) Potri.017G139000 [exp] 66 / 4e-13 AT1G74520 119 / 5e-32 HVA22 homologue A (.1) Potri.009G113400 [exp] 61 / 7e-12 AT4G36720 241 / 1e-81 HVA22-like protein K (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032557 [exp] 209 / 9e-71 AT5G50720 172 / 8e-57 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Lus10043186 [exp] 204 / 1e-68 AT5G50720 169 / 1e-55 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Lus10023605 [exp] 120 / 8e-35 AT1G74520 246 / 7e-84 HVA22 homologue A (.1) Lus10024234 [exp] 120 / 1e-34 AT1G74520 244 / 5e-83 HVA22 homologue A (.1) Lus10042193 [exp] 117 / 4e-31 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1) Lus10031386 [exp] 108 / 9e-31 AT2G42820 246 / 4e-85 HVA22-like protein F (.1) Lus10010944 [exp] 107 / 3e-30 AT2G42820 246 / 7e-85 HVA22-like protein F (.1) Lus10037191 [exp] 107 / 1e-29 AT1G69700 231 / 6e-78 HVA22 homologue C (.1) Lus10008623 [exp] 99 / 1e-26 AT1G74520 234 / 5e-80 HVA22 homologue A (.1) Lus10024332 [exp] 57 / 3e-10 AT5G42560 330 / 9e-114 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [poplar] [flax] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Potri.015G099700.2 pacid=42776588 polypeptide=Potri.015G099700.2.p locus=Potri.015G099700 ID=Potri.015G099700.2.v4.1 annot-version=v4.1 ATGGGTCGTTTTTGGACTTTTCTCACTCATGTTCACACACTATCTGGGCCAGTCATGATGTTGCTCTACCCCTTGTATGCATCAGTAATTGCTATAGAGA GTCCATCAAGGGAGGATGATGAGCAGTGGCTTGCTTATTGGATCTTATATTCATTTCTAACACTTACAGAGATGCTGCTCCAATCCATTTTAGAGTGGAT TCCTATATGGTACTCTTTGAAATTGGTGGTGGCTGCATGGTTGGTTCTACCACAGTTCAAAGGTGCAGCTTTCATTTATGAAAGGTTTGTGAGAGAGCAT ATCAGGAAATTTATAGGGGAAAAAGATCATCCCCATCACAAGTCTACCACTGCCAGTGGTAGTGGTGGTGGCGGCAAAGGCAAGAACAAGTTCGTTCACT TCATATCCCCCAATAAAGGAGAACATGAGGTTTCCTGA
AA sequence Show only first row Show all	>Potri.015G099700.2 pacid=42776588 polypeptide=Potri.015G099700.2.p locus=Potri.015G099700 ID=Potri.015G099700.2.v4.1 annot-version=v4.1 MGRFWTFLTHVHTLSGPVMMLLYPLYASVIAIESPSREDDEQWLAYWILYSFLTLTEMLLQSILEWIPIWYSLKLVVAAWLVLPQFKGAAFIYERFVREH IRKFIGEKDHPHHKSTTASGSGGGGKGKNKFVHFISPNKGEHEVS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G50720		ATHVA22E	ARABIDOPSIS THALIANA HVA22 HOM...		Potri.015G099700 [exp]	0	1
AT1G07430		HAI2	highly ABA-induced PP2C gene 2...		Potri.001G092100 [exp]	1.41	0.9132
AT2G38905			Low temperature and salt respo...		Potri.008G044300 [exp]	3.87	0.9046
					Potri.010G115900 [exp]	3.87	0.9428
AT1G27990			unknown protein		Potri.003G168400 [exp]	4.89	0.8737
AT2G25890			Oleosin family protein (.1)		Potri.006G234900 [exp]	11.09	0.8635
AT5G63030		GRXC1	glutaredoxin C1, Thioredoxin s...		Potri.012G082800 [exp]	13.56	0.9013
AT3G22600			Bifunctional inhibitor/lipid-t...		Potri.010G085300 [exp]	16.27	0.9005
AT5G38760			Late embryogenesis abundant pr...		Potri.004G107900 [exp]	17.49	0.9003
AT4G03540			Uncharacterised protein family...		Potri.004G043300 [exp]	19.26	0.8971
AT2G47770		ATTSPO	TSPO(outer membrane tryptophan...		Potri.002G206100 [exp]	20.61	0.8841

Compare expression of checked genes

Potri.015G099700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.