Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25050 122 / 2e-36 ACP4 acyl carrier protein 4 (.1.2) AT3G05020 104 / 2e-29 ACP1 acyl carrier protein 1 (.1) AT5G27200 103 / 5e-29 ACP5 acyl carrier protein 5 (.1) AT1G54580 100 / 4e-28 ACP2 acyl carrier protein 2 (.1) AT1G54630 100 / 9e-28 ACP3 acyl carrier protein 3 (.1.2) AT1G65290 47 / 1e-07 MTACP2 mitochondrial acyl carrier protein 2 (.1) AT2G44620 45 / 2e-06 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1) AT5G47630 42 / 2e-05 MTACP3 mitochondrial acyl carrier protein 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G105300 [exp] 222 / 6e-76 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2) Potri.005G044800 [exp] 127 / 2e-38 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1) Potri.013G031300 [exp] 124 / 3e-37 AT3G05020 142 / 1e-44 acyl carrier protein 1 (.1) Potri.006G217800 [exp] 92 / 2e-24 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2) Potri.013G084500 [exp] 52 / 2e-09 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1) Potri.019G055300 [exp] 49 / 4e-08 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1) Potri.014G044000 [exp] 45 / 1e-06 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1) Potri.016G006300 [exp] 45 / 2e-06 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2) Potri.006G005700 [exp] 42 / 2e-05 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018986 [exp] 138 / 9e-43 AT4G25050 136 / 3e-42 acyl carrier protein 4 (.1.2) Lus10033836 [exp] 136 / 4e-42 AT4G25050 137 / 2e-42 acyl carrier protein 4 (.1.2) Lus10038636 [exp] 128 / 8e-39 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2) Lus10038635 [exp] 128 / 8e-39 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2) Lus10037908 [exp] 126 / 4e-38 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2) Lus10037910 [exp] 125 / 5e-38 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2) Lus10026849 [exp] 54 / 6e-09 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3) Lus10020221 [exp] 51 / 1e-08 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1) Lus10019500 [exp] 45 / 2e-06 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10043348 [exp] 45 / 2e-06 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0314 [poplar] [flax] PP-binding PF00550 [poplar] [flax] PP-binding Phosphopantetheine attachment site
Representative CDS sequence Show only first row Show all	>Potri.015G104500.1 pacid=42776153 polypeptide=Potri.015G104500.1.p locus=Potri.015G104500 ID=Potri.015G104500.1.v4.1 annot-version=v4.1 ATGGCCTCAGTCTCAGCTACTTGTCCTAGGTTCCAACCTCTGTTTAGCCAGTCCAACAAGACTAGTCGGGCAGCTGGTTTAAAGCTGGATTCAGTAGGTT GGGCAAAGTGTACCGGCTTCCCTCCCTTGAAGGCCTCTCGATTTCGTGTCTCTTGTTCGGCAAAGCCAGAGACAGTGGAGAAAGTTATTGAGATTGTGAA GAAACAACTGGCTTTAAAACCTGAGACAGTGCTCACCAATGAAACAGAGTTCGTTGAGCTTGGTGCTGATTCTCTTGACACGGTGGAGATAGTAATGACA TTGGAAGAAGAATTTGACATTAATGTAGAAGAGGAGAGCTCTCAAAATATAACAACAGTCCAGGAAGTAGCTGACATGATTGAGAAACTTGTTCAGAAGA AAGCTGAAGGTGAAAGCTGA
AA sequence Show only first row Show all	>Potri.015G104500.1 pacid=42776153 polypeptide=Potri.015G104500.1.p locus=Potri.015G104500 ID=Potri.015G104500.1.v4.1 annot-version=v4.1 MASVSATCPRFQPLFSQSNKTSRAAGLKLDSVGWAKCTGFPPLKASRFRVSCSAKPETVEKVIEIVKKQLALKPETVLTNETEFVELGADSLDTVEIVMT LEEEFDINVEEESSQNITTVQEVADMIEKLVQKKAEGES

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25050		ACP4	acyl carrier protein 4 (.1.2)		Potri.015G104500 [exp]	0	1
AT1G56190			Phosphoglycerate kinase family...		Potri.010G171500 [exp]	1.41	0.9777	Pt-PGK1.1
AT1G56190			Phosphoglycerate kinase family...		Potri.008G084500 [exp]	1.41	0.9821
AT4G09010		TL29, APX4	thylakoid lumen 29, ascorbate ...		Potri.005G161900 [exp]	2.44	0.9753
AT2G39730		RCA	rubisco activase (.1.2.3)		Potri.008G058500 [exp]	5.91	0.9740	RCA.2
AT3G04760			Pentatricopeptide repeat (PPR-...		Potri.013G047000 [exp]	6.00	0.9722
AT4G01150			unknown protein		Potri.014G093900 [exp]	6.32	0.9745	CAM2.1
AT1G17840		AtABCG11, WBC11...	DESPERADO, CUTICULAR DEFECT AN...		Potri.001G312300 [exp]	7.74	0.9587
AT1G32080		AtLrgB	membrane protein, putative (.1...		Potri.003G099600 [exp]	10.58	0.9625
AT1G32470			Single hybrid motif superfamil...		Potri.001G144800 [exp]	12.32	0.9679	gdcH4,GDCH.2
AT2G26500			cytochrome b6f complex subunit...		Potri.004G147300 [exp]	14.83	0.9648

Compare expression of checked genes

Potri.015G104500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.