Potri.015G106101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01570 37 / 0.0004 Protein of unknown function (DUF604) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G107800 51 / 3e-09 AT4G23490 546 / 0.0 Protein of unknown function (DUF604) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007923 37 / 0.0003 AT4G11350 397 / 5e-135 Protein of unknown function (DUF604) (.1), Protein of unknown function (DUF604) (.2)
Lus10036382 37 / 0.0003 AT4G11350 580 / 0.0 Protein of unknown function (DUF604) (.1), Protein of unknown function (DUF604) (.2)
PFAM info
Representative CDS sequence
>Potri.015G106101.1 pacid=42776142 polypeptide=Potri.015G106101.1.p locus=Potri.015G106101 ID=Potri.015G106101.1.v4.1 annot-version=v4.1
ATGTTTCACATTTGTGACTGGGAAATAGGCCGTCCTTTACAAATAGATCGAGTGGAGGTTCATAAGAGACCTAAACCTTACCTTACCTATGGGATGGGGC
TCCTAGAAGAAACTGTTGCAGAACCTTACCCACAGAGAAAAAATGACACGTTGGAAGTTCAGGTAGCAGAATGCAGAGAAGATGATGAAGTCATTGAAGT
TCGGTGA
AA sequence
>Potri.015G106101.1 pacid=42776142 polypeptide=Potri.015G106101.1.p locus=Potri.015G106101 ID=Potri.015G106101.1.v4.1 annot-version=v4.1
MFHICDWEIGRPLQIDRVEVHKRPKPYLTYGMGLLEETVAEPYPQRKNDTLEVQVAECREDDEVIEVR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G41460 Protein of unknown function (D... Potri.015G106101 0 1
AT1G05065 CLE20 CLAVATA3/ESR-RELATED 20 (.1) Potri.014G156600 3.16 0.8830
AT5G66815 unknown protein Potri.014G034500 3.74 0.9073
AT5G51810 AT2353, GA20OX2... gibberellin 20 oxidase 2 (.1) Potri.012G132400 3.87 0.8964 Pt-GA20.1,GA20ox6
AT4G32810 MAX4, CCD8, ATC... MORE AXILLARY BRANCHING 4, car... Potri.018G044100 6.63 0.8835
Potri.019G005913 8.77 0.8713
Potri.003G056450 11.48 0.8402
AT5G49610 F-box family protein (.1) Potri.015G028500 13.56 0.7774
AT5G62065 Bifunctional inhibitor/lipid-t... Potri.015G142100 13.96 0.8202
AT3G14720 ATMPK19 ARABIDOPSIS THALIANA MAP KINAS... Potri.011G102500 15.49 0.8183 Pt-TDY1.1
Potri.019G133300 15.58 0.7518

Potri.015G106101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.