Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26880 185 / 4e-62 Ribosomal protein L34e superfamily protein (.1.2) AT1G69620 183 / 2e-61 RPL34 ribosomal protein L34 (.1) AT3G28900 179 / 2e-59 Ribosomal protein L34e superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G106532 [exp] 191 / 1e-64 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2) Potri.017G082200 [exp] 191 / 2e-64 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108400 [exp] 191 / 2e-64 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.001G195101 [exp] 182 / 9e-61 AT1G26880 178 / 3e-59 Ribosomal protein L34e superfamily protein (.1.2) Potri.004G029400 [exp] 169 / 2e-55 AT1G26880 168 / 6e-55 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108301 [exp] 108 / 4e-32 AT1G26880 105 / 3e-31 Ribosomal protein L34e superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042199 [exp] 186 / 2e-62 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10037177 [exp] 186 / 2e-62 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10012829 [exp] 186 / 3e-62 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10030477 [exp] 186 / 3e-62 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10036750 [exp] 184 / 1e-61 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10008617 [exp] 183 / 3e-61 AT1G26880 215 / 8e-74 Ribosomal protein L34e superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01199 [poplar] [flax] Ribosomal_L34e Ribosomal protein L34e
Representative CDS sequence Show only first row Show all	>Potri.015G106466.1 pacid=42775600 polypeptide=Potri.015G106466.1.p locus=Potri.015G106466 ID=Potri.015G106466.1.v4.1 annot-version=v4.1 ATGGTGCAGCGTCTGACTTACCGGAAGCGTCACAGCTACGCCACCAAGTCTAACCAACACCGTGTGGTGAAAACTCCTGGTGGGAAATTGATTTACCAAA CCACCAAGAAGAGAGCTAGCGGACCCAAGTGCCCAGTTACTGGCAAGAGGATTCAAGGGATCCCTCACTTGAGACCTGCCGAATACAAGAGGTCTAGATT GTCTAGGAACCGCAGGACTGTGAACCGTGCCTATGGAGGAGTCTTGTCTGGAAGCGCTGTTCGGGAGAGAATAATCCGAGCCTTCTTGGTGGAGGAGCAA AAGATTGTGAAGAAGGTTTTGAAGATCCAGAAGTCAAAAGAAAAACAAGCCTCAAAGAGCTAA
AA sequence Show only first row Show all	>Potri.015G106466.1 pacid=42775600 polypeptide=Potri.015G106466.1.p locus=Potri.015G106466 ID=Potri.015G106466.1.v4.1 annot-version=v4.1 MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQ KIVKKVLKIQKSKEKQASKS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G26880			Ribosomal protein L34e superfa...		Potri.015G106466 [exp]	0	1
AT1G26880			Ribosomal protein L34e superfa...		Potri.015G106532 [exp]	2.44	0.9598
AT3G10950			Zinc-binding ribosomal protein...		Potri.014G052400 [exp]	4.24	0.9441
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.016G085800 [exp]	4.89	0.9631	Pt-RPS23.5
AT3G53740			Ribosomal protein L36e family ...		Potri.011G066000 [exp]	6.32	0.9451
AT1G73230			Nascent polypeptide-associated...		Potri.017G141100 [exp]	9.53	0.9417
AT1G09690			Translation protein SH3-like f...		Potri.001G071100 [exp]	10.67	0.9230	RPL21.2
AT1G20580			Small nuclear ribonucleoprotei...		Potri.005G251100 [exp]	11.00	0.8796
AT1G09690			Translation protein SH3-like f...		Potri.003G159500 [exp]	11.53	0.9475	RPL21.1
AT3G02560			Ribosomal protein S7e family p...		Potri.004G099200 [exp]	12.00	0.9543
AT4G25740			RNA binding Plectin/S10 domain...		Potri.004G073500 [exp]	12.64	0.9522

Compare expression of checked genes

Potri.015G106466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.