Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59280 171 / 1e-56 TXR1 THAXTOMIN A RESISTANT 1, Protein Transporter, Pam16 (.1) AT5G61880 163 / 2e-53 Protein Transporter, Pam16 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G108600 [exp] 226 / 2e-78 AT3G59280 171 / 1e-56 THAXTOMIN A RESISTANT 1, Protein Transporter, Pam16 (.1) Potri.014G151200 [exp] 181 / 2e-60 AT3G59280 187 / 7e-63 THAXTOMIN A RESISTANT 1, Protein Transporter, Pam16 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043207 [exp] 162 / 4e-52 AT3G59280 156 / 2e-49 THAXTOMIN A RESISTANT 1, Protein Transporter, Pam16 (.1) Lus10032532 [exp] 118 / 7e-35 AT3G59280 114 / 4e-33 THAXTOMIN A RESISTANT 1, Protein Transporter, Pam16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [poplar] [flax] Chaperone-J PF03656 [poplar] [flax] Pam16 Pam16
Representative CDS sequence Show only first row Show all	>Potri.015G106600.3 pacid=42775774 polypeptide=Potri.015G106600.3.p locus=Potri.015G106600 ID=Potri.015G106600.3.v4.1 annot-version=v4.1 ATGGCTGCCAGGCTGCTTGCTAATTTACTTGTTATGGGCTCTGGAATTATGGTGAGGGCCTTTGCTCAAGCATACCGTCAGGCACTTGCAAATGCTTCAA AATCTGGTGTTGCCCAAGAAACAGTGCAGAATATTAGAAGAGGAAGTAAAATGATGGCTGAACCAGAGGCCAGGCAAGTTCTAGGCATCACTGAGCATTC AACATGGGAGGAGATCTTGCAGAAATATGACAAATTGTTTGAGAATAATGCCAAAAATGGGAGCTTTTATCTGCAGTCAAAGGTTCATAGAGCTAAAGAA TGCCTTGAAGAAGTATATCAAAAGAAAGCGGAGGGAAATTCATGA
AA sequence Show only first row Show all	>Potri.015G106600.3 pacid=42775774 polypeptide=Potri.015G106600.3.p locus=Potri.015G106600 ID=Potri.015G106600.3.v4.1 annot-version=v4.1 MAARLLANLLVMGSGIMVRAFAQAYRQALANASKSGVAQETVQNIRRGSKMMAEPEARQVLGITEHSTWEEILQKYDKLFENNAKNGSFYLQSKVHRAKE CLEEVYQKKAEGNS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Potri.015G106600 [exp]	0	1
AT5G18810		SCL28, At-SCL28	SC35-like splicing factor 28 (...		Potri.008G196700 [exp]	1.73	0.8147
AT2G36930	C2H2ZnF		zinc finger (C2H2 type) family...		Potri.006G124100 [exp]	2.00	0.7876
AT2G04230			FBD, F-box and Leucine Rich Re...		Potri.004G020200 [exp]	4.24	0.8070
AT5G10270		CDKC;1	cyclin-dependent kinase C;1 (....		Potri.012G003700 [exp]	6.70	0.7895	CDC2.6
AT4G13520		SMAP1	small acidic protein 1 (.1)		Potri.008G174000 [exp]	10.95	0.7823
AT3G46580		MBD05, MDB5, MD...	METHYL-CPG-BINDING DOMAIN PROT...		Potri.009G031100 [exp]	14.24	0.7770	MBD5.2,MBD904
AT4G13520		SMAP1	small acidic protein 1 (.1)		Potri.010G063100 [exp]	16.91	0.7503
AT3G49660		AtWDR5a	human WDR5 \(WD40 repeat\) hom...		Potri.005G148500 [exp]	19.23	0.7640
AT3G58090			Disease resistance-responsive ...		Potri.006G216000 [exp]	20.97	0.7352
AT3G04950			unknown protein		Potri.013G034100 [exp]	21.21	0.6810

Compare expression of checked genes

Potri.015G106600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.