Potri.015G107200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61840 327 / 2e-112 GUT1, IRX10-L Exostosin family protein (.1)
AT1G27440 305 / 5e-104 ATGUT1, IRX10, GUT2 Exostosin family protein (.1)
AT5G22940 126 / 3e-34 F8H FRA8 homolog (.1)
AT2G28110 113 / 2e-29 IRX7, FRA8 IRREGULAR XYLEM 7, FRAGILE FIBER 8, Exostosin family protein (.1)
AT5G37000 78 / 1e-16 Exostosin family protein (.1)
AT5G03795 75 / 9e-16 Exostosin family protein (.1)
AT5G25820 74 / 3e-15 Exostosin family protein (.1)
AT5G11610 72 / 8e-15 Exostosin family protein (.1.2)
AT5G11130 69 / 1e-13 Exostosin family protein (.1)
AT4G38040 69 / 1e-13 Exostosin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G116700 330 / 2e-114 AT5G61840 619 / 0.0 Exostosin family protein (.1)
Potri.012G109200 331 / 7e-114 AT5G61840 752 / 0.0 Exostosin family protein (.1)
Potri.012G109600 331 / 7e-114 AT5G61840 750 / 0.0 Exostosin family protein (.1)
Potri.001G068100 308 / 6e-105 AT1G27440 752 / 0.0 Exostosin family protein (.1)
Potri.003G162000 306 / 3e-104 AT1G27440 705 / 0.0 Exostosin family protein (.1)
Potri.009G006500 131 / 6e-36 AT2G28110 596 / 0.0 IRREGULAR XYLEM 7, FRAGILE FIBER 8, Exostosin family protein (.1)
Potri.018G043700 76 / 5e-16 AT5G25820 635 / 0.0 Exostosin family protein (.1)
Potri.006G239000 75 / 1e-15 AT5G25820 607 / 0.0 Exostosin family protein (.1)
Potri.003G079000 73 / 4e-15 AT4G16745 636 / 0.0 Exostosin family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043209 318 / 1e-108 AT5G61840 773 / 0.0 Exostosin family protein (.1)
Lus10032530 318 / 1e-108 AT5G61840 773 / 0.0 Exostosin family protein (.1)
Lus10019479 304 / 3e-103 AT1G27440 731 / 0.0 Exostosin family protein (.1)
Lus10043326 303 / 3e-103 AT1G27440 735 / 0.0 Exostosin family protein (.1)
Lus10041343 129 / 3e-35 AT2G28110 608 / 0.0 IRREGULAR XYLEM 7, FRAGILE FIBER 8, Exostosin family protein (.1)
Lus10037376 99 / 5e-24 AT2G28110 501 / 5e-177 IRREGULAR XYLEM 7, FRAGILE FIBER 8, Exostosin family protein (.1)
Lus10012723 69 / 9e-14 AT4G38040 674 / 0.0 Exostosin family protein (.1)
Lus10002664 67 / 5e-13 AT4G38040 677 / 0.0 Exostosin family protein (.1)
Lus10011120 67 / 7e-13 AT4G32790 501 / 1e-172 Exostosin family protein (.1)
Lus10034951 67 / 7e-13 AT5G19670 701 / 0.0 Exostosin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03016 Exostosin Exostosin family
Representative CDS sequence
>Potri.015G107200.1 pacid=42776182 polypeptide=Potri.015G107200.1.p locus=Potri.015G107200 ID=Potri.015G107200.1.v4.1 annot-version=v4.1
ATGGATGACCAGGCATTTGGCTTTATTTCATCAAACTGGCCTTATTGGAATCGGACTGAAGGTGCTGACCACTTTTTTGTTGTGCCACACGACTTTGGTG
CATGCTTCCACTATCAAGAAGAGAAGGCTATCAAAAGAGGAATTCTTCCCTTGCTCCAACGTGCCACCTTGGTGCAAACTTTTGGACAAAGAAATCATGT
TTGCTTAAGAGATGGCTTCATTACAGTTCCTCCATATGCTCCTCCACAGAAAATGCAAACCCACCTGATTCCTGAAAAAACACCTGAGGTCAATTTTTGT
TTACTTCAGAGGATTGCTACTATGCAAGCAGTCTGGGAGAACTTCATGGACAATCCACTTTTTGACATTTCCACAGAGCACCTAACAATTCCGAGATTGG
TTAAAGTAGTAATATTTGGCTACATCGCTATTATTATAGCTGACGACATTGTTTTACCCTTTGCTGATGCAATCCCATGGGAAGAAATTGAGGTATTTGT
AGACGAGAAAGATGTTCCAAATTTGGACACCATACTCACTTCCATTCCACCTGAAGTGATATTGAGGAAGCAGAGACTGATTGCAAACCCTTCAATGAAG
CAGGCAATGCTATTCCCATAA
AA sequence
>Potri.015G107200.1 pacid=42776182 polypeptide=Potri.015G107200.1.p locus=Potri.015G107200 ID=Potri.015G107200.1.v4.1 annot-version=v4.1
MDDQAFGFISSNWPYWNRTEGADHFFVVPHDFGACFHYQEEKAIKRGILPLLQRATLVQTFGQRNHVCLRDGFITVPPYAPPQKMQTHLIPEKTPEVNFC
LLQRIATMQAVWENFMDNPLFDISTEHLTIPRLVKVVIFGYIAIIIADDIVLPFADAIPWEEIEVFVDEKDVPNLDTILTSIPPEVILRKQRLIANPSMK
QAMLFP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G61840 GUT1, IRX10-L Exostosin family protein (.1) Potri.015G107200 0 1
AT5G15350 AtENODL17 early nodulin-like protein 17 ... Potri.004G121100 2.44 0.9365
AT5G39850 Ribosomal protein S4 (.1) Potri.006G209900 3.46 0.9276
AT4G24190 AtHsp90-7, HSP9... SHEPHERD, HEAT SHOCK PROTEIN 9... Potri.002G020249 4.69 0.9124
AT4G18550 AtDSEL Arabidopsis thaliana DAD1-like... Potri.004G054800 4.69 0.9002
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Potri.011G127250 5.47 0.9352
AT5G56000 Hsp81.4, AtHsp9... HEAT SHOCK PROTEIN 90.4, HEAT ... Potri.011G163932 6.00 0.9192
AT1G78922 unknown protein Potri.007G001400 6.78 0.9000
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Potri.010G167700 11.48 0.9262
AT3G04830 Protein prenylyltransferase su... Potri.013G038501 12.48 0.9124
AT1G78922 unknown protein Potri.007G001650 17.29 0.9109

Potri.015G107200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.