Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68090 89 / 9e-23 ANN5, ANNAT5 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) AT5G65020 53 / 1e-09 ANNAT2 annexin 2 (.1.2) AT5G10220 52 / 3e-09 ANN6, ANNAT6 ANNEXIN ARABIDOPSIS THALIANA 6, annexin 6 (.1) AT5G12380 50 / 1e-08 ANNAT8 annexin 8 (.1) AT1G35720 45 / 1e-06 ATOXY5, ANNAT1 annexin 1 (.1) AT2G38760 39 / 0.0001 ANN3, ANNAT3 annexin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G041900 [exp] 169 / 5e-54 AT1G68090 358 / 3e-124 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Potri.015G031800 [exp] 151 / 1e-46 AT1G68090 356 / 3e-123 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Potri.008G139500 [exp] 96 / 2e-25 AT1G68090 363 / 4e-126 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Potri.010G101800 [exp] 71 / 4e-16 AT1G68090 343 / 3e-117 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Potri.013G055000 [exp] 56 / 1e-10 AT5G12380 144 / 1e-40 annexin 8 (.1) Potri.007G092500 [exp] 53 / 2e-09 AT5G65020 488 / 2e-175 annexin 2 (.1.2) Potri.005G075900 [exp] 51 / 5e-09 AT5G65020 472 / 3e-169 annexin 2 (.1.2) Potri.002G095600 [exp] 51 / 6e-09 AT1G35720 481 / 1e-172 annexin 1 (.1) Potri.001G277500 [exp] 49 / 2e-08 AT5G12380 442 / 3e-157 annexin 8 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040415 [exp] 138 / 9e-42 AT1G68090 306 / 2e-104 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Lus10023530 [exp] 138 / 2e-41 AT1G68090 350 / 4e-121 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Lus10009225 [exp] 112 / 2e-31 AT1G68090 358 / 3e-124 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Lus10035101 [exp] 79 / 7e-19 AT1G68090 352 / 1e-121 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Lus10031942 [exp] 76 / 6e-18 AT1G68090 353 / 2e-122 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Lus10037992 [exp] 74 / 4e-17 AT1G68090 321 / 6e-110 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Lus10003611 [exp] 50 / 2e-08 AT1G35720 476 / 1e-170 annexin 1 (.1) Lus10008227 [exp] 50 / 2e-08 AT1G35720 476 / 9e-171 annexin 1 (.1) Lus10024174 [exp] 49 / 6e-08 AT2G38760 361 / 4e-125 annexin 3 (.1) Lus10019780 [exp] 47 / 1e-07 AT5G12380 372 / 1e-129 annexin 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00191 [poplar] [flax] Annexin Annexin
Representative CDS sequence Show only first row Show all	>Potri.015G107600.1 pacid=42774930 polypeptide=Potri.015G107600.1.p locus=Potri.015G107600 ID=Potri.015G107600.1.v4.1 annot-version=v4.1 ATGGCTGAGAAGGATGCAAAGGCTCTTTATAAAGCAGGTGAGAAGAGATTGGGAACTGATGAGAAGACTTTCATCCGCGTATTCAGTGAACGAAGTGCAG CACATTTGGCTGCTGTTGATTCTGCCTATCACAACATGTATGGAAACTCTCTGAAAAAGGCTATAAAGAAGGAAACTTCAGGACATTTTGAGCATGCTTT GAAGACAATTTTACAATGCTCAGAGAATCCGGCAAAGTACTTTGTCAAGGTATCCTTCTAA
AA sequence Show only first row Show all	>Potri.015G107600.1 pacid=42774930 polypeptide=Potri.015G107600.1.p locus=Potri.015G107600 ID=Potri.015G107600.1.v4.1 annot-version=v4.1 MAEKDAKALYKAGEKRLGTDEKTFIRVFSERSAAHLAAVDSAYHNMYGNSLKKAIKKETSGHFEHALKTILQCSENPAKYFVKVSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68090		ANN5, ANNAT5	ANNEXIN ARABIDOPSIS THALIANA 5...		Potri.015G107600 [exp]	0	1
					Potri.008G031000 [exp]	6.00	0.7396
AT1G09030	CCAAT	NF-YB4	"nuclear factor Y, subunit B4"...		Potri.013G019500 [exp]	28.82	0.7598
AT5G15180			Peroxidase superfamily protein...		Potri.007G122200 [exp]	33.46	0.7534
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.006G010200 [exp]	42.05	0.6896
AT1G18530			EF hand calcium-binding protei...		Potri.015G052600 [exp]	46.78	0.7297
AT5G07300		BON2	BONZAI 2, Calcium-dependent ph...		Potri.003G055501 [exp]	49.30	0.6106
AT5G36130			Cytochrome P450 superfamily pr...		Potri.011G001350 [exp]	54.99	0.7238
AT1G11925			Stigma-specific Stig1 family p...		Potri.011G009100 [exp]	62.94	0.7288
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Potri.014G037300 [exp]	80.56	0.6925
AT1G34300			lectin protein kinase family p...		Potri.006G091400 [exp]	86.45	0.7211

Compare expression of checked genes

Potri.015G107600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.