Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51120 267 / 4e-91 PABN1, ATPABN1 polyadenylate-binding protein 1 (.1.2.3) AT5G65260 265 / 2e-90 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G10350 260 / 7e-89 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT3G12640 69 / 2e-13 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT2G16940 58 / 1e-09 Splicing factor, CC1-like (.1.2.3) AT3G55460 55 / 8e-09 SCL30, At-SCL30 SC35-like splicing factor 30 (.1) AT2G36660 55 / 1e-08 PAB7 poly(A) binding protein 7 (.1) AT3G10400 52 / 6e-08 U11/U12-31K U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT3G23830 50 / 6e-08 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT2G35410 52 / 1e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G115100 [exp] 390 / 1e-139 AT5G65260 271 / 5e-93 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.005G073200 [exp] 281 / 1e-96 AT5G10350 292 / 2e-101 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.007G095800 [exp] 274 / 5e-94 AT5G10350 285 / 3e-98 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.017G051600 [exp] 256 / 4e-87 AT5G65260 288 / 4e-100 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G311600 [exp] 233 / 6e-78 AT5G65260 238 / 2e-80 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G145050 [exp] 84 / 5e-20 AT2G24350 107 / 4e-27 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.009G063800 [exp] 70 / 1e-13 AT3G12640 418 / 6e-138 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G269200 [exp] 68 / 4e-13 AT3G12640 432 / 3e-143 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.006G079800 [exp] 60 / 2e-10 AT2G24350 102 / 8e-23 RNA binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043008 [exp] 320 / 4e-112 AT5G65260 278 / 4e-96 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10032509 [exp] 329 / 1e-109 AT5G07440 771 / 0.0 glutamate dehydrogenase 2 (.1.2.3) Lus10032510 [exp] 312 / 8e-109 AT5G65260 278 / 2e-95 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10009323 [exp] 249 / 1e-84 AT5G65260 268 / 2e-92 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10015840 [exp] 245 / 4e-83 AT5G65260 261 / 9e-90 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10037701 [exp] 75 / 3e-15 AT3G12640 412 / 2e-135 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10015696 [exp] 74 / 8e-15 AT3G12640 417 / 1e-136 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10034466 [exp] 60 / 2e-10 AT2G16940 569 / 0.0 Splicing factor, CC1-like (.1.2.3) Lus10025075 [exp] 60 / 2e-10 AT2G16940 565 / 0.0 Splicing factor, CC1-like (.1.2.3) Lus10018277 [exp] 56 / 8e-09 AT4G19610 770 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.015G110800.1 pacid=42775884 polypeptide=Potri.015G110800.1.p locus=Potri.015G110800 ID=Potri.015G110800.1.v4.1 annot-version=v4.1 ATGGATCAGCTTCACGATCACGAAGAGGATGAGCACGAGCACGAGGTGTACGGTGGAGAAATCCCCGATGAAGGAGAGATGGATGCCGATGCTGACATGT CGTCTAGAGCTGAAGAAGACGAGTACCAAGACCCTAACTCTAAGGATTTAGAGGATATGAAGAGAAGGTTGAAAGAGATCGAAGAAGAAGCTGGTGCACT ACGCGAAATGCAGGCTAAGGTTGAGAAAGAAATGGGAGCTGTTCAAGATTCTCCAGGTGCTTCTGCGACTCAAGCTGAAAAGGAGGAGGTGGATTCACGA TCCATTTATGTTGGTAATGTGGATTATTCTTGTACCCCTGAAGAAGTGCAGCAGCATTTTCAATCCTGTGGAACTGTGAACAGAGTGACAATTTTGACTG ACAAGTTTGGTCAACCAAAGGGGTTTGCTTATGTTGAGTTTATAGAGGTTGATGCTGTTCAGAATGCTGTCTTATTAAATGAATCTGAACTTCATGGCCG CCAGTTAAAGGTCTCCGCTAAGCGAACTAATGTTCCTGGAATGAAGCAATATCGAGGAAGGCGCCCAAGCCCTTATGGGTTCAGGTCCCAGAGGGCATTC ATGCCTGCTCCTTTCTATCCTGCATATGGTTATGGAAGAGTTCCAAGGTTCAGGAGACCTATGCGGTACAGGCCATACTAG
AA sequence Show only first row Show all	>Potri.015G110800.1 pacid=42775884 polypeptide=Potri.015G110800.1.p locus=Potri.015G110800 ID=Potri.015G110800.1.v4.1 annot-version=v4.1 MDQLHDHEEDEHEHEVYGGEIPDEGEMDADADMSSRAEEDEYQDPNSKDLEDMKRRLKEIEEEAGALREMQAKVEKEMGAVQDSPGASATQAEKEEVDSR SIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVEFIEVDAVQNAVLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPSPYGFRSQRAF MPAPFYPAYGYGRVPRFRRPMRYRPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G51120		PABN1, ATPABN1	polyadenylate-binding protein ...		Potri.015G110800 [exp]	0	1
AT2G34480			Ribosomal protein L18ae/LX fam...		Potri.011G072400 [exp]	2.64	0.8176	RPL18.5
AT1G07210			Ribosomal protein S18 (.1)		Potri.006G170500 [exp]	3.16	0.7884
AT2G02470	Alfin	AL6	alfin-like 6 (.1.2)		Potri.003G044700 [exp]	4.69	0.7321
AT2G33340		MAC3B	MOS4-associated complex 3B (....		Potri.008G171600 [exp]	5.47	0.7745
AT3G11400		ATEIF3G1, EIF3G...	eukaryotic translation initiat...		Potri.010G199000 [exp]	6.32	0.7688
AT1G29250			Alba DNA/RNA-binding protein (...		Potri.006G252000 [exp]	6.92	0.7514
AT4G26300		EMB1027	embryo defective 1027, Arginyl...		Potri.002G198500 [exp]	12.12	0.7494
AT5G15750			Alpha-L RNA-binding motif/Ribo...		Potri.004G113600 [exp]	13.96	0.7580
AT5G49020		ATPRMT4A	ARABIDOPSIS THALIANA PROTEIN A...		Potri.010G014600 [exp]	14.42	0.7238
AT1G19990			unknown protein		Potri.005G239600 [exp]	14.49	0.7005

Compare expression of checked genes

Potri.015G110800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.