Potri.015G112140 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44740 274 / 1e-94 CYCP4;1 cyclin p4;1 (.1)
AT5G61650 219 / 6e-73 CYCP4;2 CYCLIN P4;2 (.1)
AT5G07450 218 / 2e-72 CYCP4;3 cyclin p4;3 (.1)
AT2G45080 154 / 6e-47 CYCP3;1 cyclin p3;1 (.1)
AT3G63120 148 / 1e-44 CYCP1;1 cyclin p1;1 (.1)
AT3G60550 147 / 2e-44 CYCP3;2 cyclin p3;2 (.1)
AT3G05327 144 / 2e-43 Cyclin family protein (.1)
AT3G21870 143 / 6e-43 CYCP2;1 cyclin p2;1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G114600 379 / 1e-135 AT2G44740 277 / 2e-95 cyclin p4;1 (.1)
Potri.014G050400 322 / 2e-113 AT2G44740 285 / 8e-99 cyclin p4;1 (.1)
Potri.005G209800 174 / 4e-55 AT3G63120 223 / 7e-74 cyclin p1;1 (.1)
Potri.002G052800 172 / 4e-54 AT3G63120 219 / 1e-71 cyclin p1;1 (.1)
Potri.007G121500 164 / 8e-51 AT3G21870 228 / 5e-76 cyclin p2;1 (.1)
Potri.005G033600 154 / 3e-47 AT3G05327 184 / 5e-59 Cyclin family protein (.1)
Potri.013G023000 154 / 3e-47 AT3G05327 194 / 4e-63 Cyclin family protein (.1)
Potri.002G143400 147 / 2e-44 AT2G45080 324 / 1e-113 cyclin p3;1 (.1)
Potri.014G066400 143 / 7e-43 AT3G60550 343 / 3e-121 cyclin p3;2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032505 244 / 2e-82 AT2G44740 228 / 7e-76 cyclin p4;1 (.1)
Lus10043003 238 / 6e-80 AT2G44740 227 / 2e-75 cyclin p4;1 (.1)
Lus10022038 174 / 1e-54 AT3G63120 197 / 8e-64 cyclin p1;1 (.1)
Lus10042582 173 / 2e-54 AT3G63120 191 / 2e-61 cyclin p1;1 (.1)
Lus10029933 165 / 2e-51 AT3G05327 172 / 3e-54 Cyclin family protein (.1)
Lus10004475 164 / 4e-51 AT3G05327 171 / 1e-53 Cyclin family protein (.1)
Lus10039697 159 / 7e-49 AT3G21870 236 / 3e-79 cyclin p2;1 (.1)
Lus10027148 157 / 1e-47 AT3G21870 233 / 6e-77 cyclin p2;1 (.1)
Lus10042873 152 / 3e-46 AT3G60550 300 / 8e-104 cyclin p3;2 (.1)
Lus10028174 144 / 1e-43 AT2G45080 249 / 1e-84 cyclin p3;1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0065 Cyclin PF00134 Cyclin_N Cyclin, N-terminal domain
Representative CDS sequence
>Potri.015G112140.1 pacid=42775779 polypeptide=Potri.015G112140.1.p locus=Potri.015G112140 ID=Potri.015G112140.1.v4.1 annot-version=v4.1
ATGGCAGAATTAGCAGAGACTGCAGTGATGCCTAAGGTCATAACTTTCCTCTCTTCTCTTCTTCAAAGAGTAGCAGAATCTAATGATATTAGCCATCAGT
TATACCCCCAGAAAGCCTCAATCTTTCATGGCCTAACGAGACCTACTATATCCATTCAAAACTATCTTGAGAGAATCTTCAAGTATTCAAATTGTAGCCC
CTCTTGTTTTGTTGTTGCTTATGTGTATCTTGATCGGTTTTCTCAGAGACAATCCTGTTTTCCTCTCAATTCTTTCAATGTGCATAGATTGCTCATCACA
AGTGTCTTGGTCTCTGTCAAGTTCATGGATGATATATATTACAACAACGCATTCTATGCTAAAGTTGGAGGAATCAGCACAAGAGAGATGAATCTTCTTG
AAGTGGATTTTTTATTTGGTCTAGGCTTCCAGTTGAATGTGACACCAACCACATTCCACCTCTATTGCTCTTACCTTCAGAGAGAAATGTCGATTCAGTC
TCCTCTGCAAATAGTAGACACTCCTCTAAATATCGCAAGACCACTGAAAATCCATTGCTGTTTCAATGAAGATGAATCCACTCATCAAAAACAGCTTGCT
GTTTAG
AA sequence
>Potri.015G112140.1 pacid=42775779 polypeptide=Potri.015G112140.1.p locus=Potri.015G112140 ID=Potri.015G112140.1.v4.1 annot-version=v4.1
MAELAETAVMPKVITFLSSLLQRVAESNDISHQLYPQKASIFHGLTRPTISIQNYLERIFKYSNCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLIT
SVLVSVKFMDDIYYNNAFYAKVGGISTREMNLLEVDFLFGLGFQLNVTPTTFHLYCSYLQREMSIQSPLQIVDTPLNIARPLKIHCCFNEDESTHQKQLA
V

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G44740 CYCP4;1 cyclin p4;1 (.1) Potri.015G112140 0 1
AT2G30490 REF3, CYP73A5, ... REDUCED EPRDERMAL FLUORESCENCE... Potri.006G078101 6.24 0.9357
AT3G49940 AS2 LBD38 LOB domain-containing protein ... Potri.001G295700 7.68 0.8766
AT3G08900 RGP3 reversibly glycosylated polype... Potri.015G060300 11.66 0.9226 RGP3.3
AT3G19940 Major facilitator superfamily ... Potri.007G073800 11.74 0.9152
AT1G67950 RNA-binding (RRM/RBD/RNP motif... Potri.010G103600 12.32 0.9339
AT3G19940 Major facilitator superfamily ... Potri.007G073850 15.68 0.8986
AT4G10260 pfkB-like carbohydrate kinase ... Potri.019G063600 16.79 0.9325
AT3G19940 Major facilitator superfamily ... Potri.007G073900 19.49 0.8580
AT5G39050 PMAT1 phenolic glucoside malonyltran... Potri.004G110400 23.08 0.9238
AT5G19760 Mitochondrial substrate carrie... Potri.001G004366 24.69 0.9262

Potri.015G112140 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.