Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ARA7.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45130 339 / 2e-120 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) AT4G19640 338 / 3e-120 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) AT3G54840 214 / 6e-71 ARA6, AtRABF1, Ara-6, AtRab5C Ras-related small GTP-binding family protein (.1.2) AT5G45750 151 / 4e-46 AtRABA1c RAB GTPase homolog A1C (.1) AT4G18800 150 / 1e-45 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT4G18430 149 / 2e-45 AtRABA1e RAB GTPase homolog A1E (.1) AT1G06400 149 / 3e-45 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT1G07410 149 / 4e-45 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT1G16920 148 / 6e-45 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G60860 148 / 9e-45 AtRABA1f RAB GTPase homolog A1F (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G117800 [exp] 372 / 2e-133 AT5G45130 357 / 1e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.018G079300 [exp] 278 / 3e-96 AT5G45130 273 / 2e-94 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.003G054900 [exp] 262 / 8e-90 AT4G19640 270 / 4e-93 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Potri.008G035800 [exp] 214 / 7e-71 AT3G54840 367 / 3e-131 Ras-related small GTP-binding family protein (.1.2) Potri.010G226300 [exp] 211 / 5e-70 AT3G54840 373 / 7e-134 Ras-related small GTP-binding family protein (.1.2) Potri.010G197200 [exp] 154 / 2e-47 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.019G092500 [exp] 154 / 5e-47 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.013G123600 [exp] 151 / 4e-46 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.001G374000 [exp] 148 / 6e-45 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040625 [exp] 336 / 6e-119 AT5G45130 355 / 6e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10018285 [exp] 333 / 9e-118 AT5G45130 359 / 3e-128 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10038334 [exp] 320 / 8e-113 AT5G45130 349 / 3e-124 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10034903 [exp] 236 / 2e-79 AT5G45130 258 / 2e-88 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10036196 [exp] 210 / 1e-70 AT5G45130 214 / 2e-72 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10036198 [exp] 207 / 4e-69 AT4G19640 216 / 8e-73 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Lus10028820 [exp] 206 / 6e-68 AT3G54840 354 / 3e-126 Ras-related small GTP-binding family protein (.1.2) Lus10017462 [exp] 203 / 2e-64 AT3G54840 349 / 1e-121 Ras-related small GTP-binding family protein (.1.2) Lus10025432 [exp] 150 / 8e-46 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10002178 [exp] 150 / 1e-45 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.015G113000.9 pacid=42775372 polypeptide=Potri.015G113000.9.p locus=Potri.015G113000 ID=Potri.015G113000.9.v4.1 annot-version=v4.1 ATGGCCACCACTGCAAACAAGAATATCAATGCTAAATTGGTGCTTCTCGGGGATGTTGGTGCAGGAAAGTCCAGTCTTGTACTGCGTTTTGTTAAAGGAC AGTTTGTTGAGTTCCAGGAATCAACCATAGGTGCTGCCTTTTTCTCGCAAACATTGGCTGTCAATGATGCAACTGTAAAATTTGAGATTTGGGACACAGC AGGTCAGGAGAGATACCACAGCTTAGCTCCAATGTACTACAGGGGAGCTGCAGCAGCAATTATTGTGTATGATATATCAAATCAGGCCTCATTTGAGCGA GCAAAAAAATGGGTTCAAGAACTTCAAGCACAAGGCAACCCAAATATGGTTATGGCACTTGCGGGGAACAAAGCTGATTTGCTAGATGCAAGGAAGGTTG CTGCCGAGGAAGCACAAGTTTTTGCTCAGGAGAATGGTCTTTTCTTTATGGAAACCTCAGCGAAAACCGCAACCAATGTCAATGACATTTTCTATGAAAT AGCAAAAAGACTATCTCAAGTACAGCCAGCGCCAAACCCTTCTGGAATGGTTATCATGGATAGACCTACAGAAAGGACAGCTAGTGCAGCTTGCTGCTCA TAA
AA sequence Show only first row Show all	>Potri.015G113000.9 pacid=42775372 polypeptide=Potri.015G113000.9.p locus=Potri.015G113000 ID=Potri.015G113000.9.v4.1 annot-version=v4.1 MATTANKNINAKLVLLGDVGAGKSSLVLRFVKGQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDISNQASFER AKKWVQELQAQGNPNMVMALAGNKADLLDARKVAAEEAQVFAQENGLFFMETSAKTATNVNDIFYEIAKRLSQVQPAPNPSGMVIMDRPTERTASAACCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Potri.015G113000 [exp]	0	1	ARA7.2
AT5G09260		VPS20.2	vacuolar protein sorting-assoc...		Potri.005G067700 [exp]	1.73	0.8829	ATHDH.2
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Potri.008G051700 [exp]	2.44	0.8452	Pt-RAB1.11
AT5G20090			Uncharacterised protein family...		Potri.012G095133 [exp]	10.00	0.8291
AT5G42000			ORMDL family protein (.1.2)		Potri.003G144600 [exp]	12.64	0.7747
AT4G16695			unknown protein		Potri.001G156500 [exp]	13.96	0.8223
AT4G20410		GAMMA-SNAP, GSN...	gamma-soluble NSF attachment p...		Potri.001G440600 [exp]	14.28	0.8350	Pt-GSNAP.2
AT5G58060		ATYKT61, ATGP1,...	SNARE-like superfamily protein...		Potri.018G110700 [exp]	14.86	0.7794
AT3G29170			Eukaryotic protein of unknown ...		Potri.006G053300 [exp]	19.28	0.6954
AT1G60430		ARPC3	actin-related protein C3 (.1.2...		Potri.018G123100 [exp]	19.59	0.7907
AT5G64180			unknown protein		Potri.012G022200 [exp]	26.24	0.7875

Compare expression of checked genes

Potri.015G113000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.