Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45110 98 / 3e-25 ATNPR3, NPR3 NPR1-like protein 3 (.1) AT4G19660 86 / 7e-21 ATNPR4, NPR4 NPR1-like protein 4 (.1) AT4G26120 49 / 9e-08 Ankyrin repeat family protein / BTB/POZ domain-containing protein (.1) AT1G64280 45 / 1e-06 SAI1, NIM1, NPR1, ATNPR1 SALICYLIC ACID INSENSITIVE 1, NON-INDUCIBLE IMMUNITY 1, ARABIDOPSIS NONEXPRESSER OF PR GENES 1, regulatory protein (NPR1) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G116900 [exp] 183 / 4e-61 AT5G45110 169 / 3e-50 NPR1-like protein 3 (.1) Potri.015G117200 [exp] 177 / 5e-54 AT5G45110 656 / 0.0 NPR1-like protein 3 (.1) Potri.012G118500 [exp] 169 / 2e-51 AT5G45110 644 / 0.0 NPR1-like protein 3 (.1) Potri.012G118300 [exp] 168 / 2e-51 AT5G45110 566 / 0.0 NPR1-like protein 3 (.1) Potri.002G056500 [exp] 105 / 1e-27 AT5G45110 518 / 1e-178 NPR1-like protein 3 (.1) Potri.005G206100 [exp] 85 / 1e-20 AT5G45110 531 / 0.0 NPR1-like protein 3 (.1) Potri.006G148100 [exp] 77 / 7e-18 AT1G64280 596 / 0.0 SALICYLIC ACID INSENSITIVE 1, NON-INDUCIBLE IMMUNITY 1, ARABIDOPSIS NONEXPRESSER OF PR GENES 1, regulatory protein (NPR1) (.1) Potri.015G114501 [exp] 63 / 1e-14 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018289 [exp] 140 / 2e-40 AT5G45110 650 / 0.0 NPR1-like protein 3 (.1) Lus10040620 [exp] 140 / 2e-40 AT5G45110 647 / 0.0 NPR1-like protein 3 (.1) Lus10038337 [exp] 83 / 7e-20 AT5G45110 575 / 0.0 NPR1-like protein 3 (.1) Lus10036200 [exp] 80 / 8e-19 AT5G45110 489 / 6e-168 NPR1-like protein 3 (.1) Lus10018756 [exp] 64 / 3e-13 AT1G64280 506 / 2e-170 SALICYLIC ACID INSENSITIVE 1, NON-INDUCIBLE IMMUNITY 1, ARABIDOPSIS NONEXPRESSER OF PR GENES 1, regulatory protein (NPR1) (.1) Lus10024842 [exp] 63 / 1e-12 AT4G26120 316 / 7e-103 Ankyrin repeat family protein / BTB/POZ domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12313 [poplar] [flax] NPR1_like_C NPR1/NIM1 like defence protein C terminal
Representative CDS sequence Show only first row Show all	>Potri.015G113466.2 pacid=42775070 polypeptide=Potri.015G113466.2.p locus=Potri.015G113466 ID=Potri.015G113466.2.v4.1 annot-version=v4.1 ATGAGAAGGAATACAATGGCCGGGAGTGCCTCCATCACTTCCCATACAATGGATGATGATCTTCACATGAAGCTGCTATACCTGAAGAACAGAGTGGCAT TTGCAAGATTATTCTTCCCTACTGAAGCCAAGCTAGCCATGGACATTGGACATACTGCAACAACACCAGAATTCGCTGGTCTTGCTGCATCAAAAGGTTC TGACGGGAATTTGAGGGGGGCTGACCTAGATGAGACACCAATAATGCAGAACATAAGACTTCGTTCTAGGATGGAAGCCCTAACGAAAACAGGTACATGG AAACTATGA
AA sequence Show only first row Show all	>Potri.015G113466.2 pacid=42775070 polypeptide=Potri.015G113466.2.p locus=Potri.015G113466 ID=Potri.015G113466.2.v4.1 annot-version=v4.1 MRRNTMAGSASITSHTMDDDLHMKLLYLKNRVAFARLFFPTEAKLAMDIGHTATTPEFAGLAASKGSDGNLRGADLDETPIMQNIRLRSRMEALTKTGTW KL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45110		ATNPR3, NPR3	NPR1-like protein 3 (.1)		Potri.015G113466 [exp]	0	1
AT5G13190		AtGILP	GSH-induced LITAF domain prote...		Potri.001G061900 [exp]	1.73	0.8761
AT4G21570			Protein of unknown function (D...		Potri.001G405700 [exp]	2.23	0.8526
AT5G45110		ATNPR3, NPR3	NPR1-like protein 3 (.1)		Potri.015G116900 [exp]	2.44	0.8837
AT1G25500			Plasma-membrane choline transp...		Potri.008G118200 [exp]	3.46	0.8160
AT3G04860			Plant protein of unknown funct...		Potri.005G050000 [exp]	3.74	0.8250
AT2G44930			Plant protein of unknown funct...		Potri.017G019700 [exp]	7.41	0.8169
AT2G28230			TATA-binding related factor (T...		Potri.006G143400 [exp]	8.48	0.7980
AT1G21980		ATPIPK1, ATPIP5...	phosphatidylinositol-4-phospha...		Potri.019G015768 [exp]	8.83	0.8441
					Potri.015G114501 [exp]	8.94	0.7967
AT3G14420			Aldolase-type TIM barrel famil...		Potri.004G065200 [exp]	10.58	0.8236

Compare expression of checked genes

Potri.015G113466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.