Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31200 66 / 3e-14 ATPP2-A9 phloem protein 2-A9 (.1) AT1G10155 61 / 2e-12 ATPP2-A10 phloem protein 2-A10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G118850 [exp] 204 / 3e-69 AT1G31200 69 / 3e-15 phloem protein 2-A9 (.1) Potri.015G118900 [exp] 205 / 7e-68 AT1G10155 103 / 5e-27 phloem protein 2-A10 (.1) Potri.015G118800 [exp] 156 / 2e-48 AT1G10155 86 / 4e-20 phloem protein 2-A10 (.1) Potri.015G120000 [exp] 150 / 2e-46 AT1G10155 82 / 6e-19 phloem protein 2-A10 (.1) Potri.015G120200 [exp] 85 / 2e-21 AT1G10155 137 / 4e-41 phloem protein 2-A10 (.1) Potri.012G120280 [exp] 84 / 3e-21 AT1G10155 125 / 1e-36 phloem protein 2-A10 (.1) Potri.012G120160 [exp] 79 / 4e-19 AT1G10155 120 / 1e-34 phloem protein 2-A10 (.1) Potri.015G120100 [exp] 78 / 4e-19 AT1G10155 122 / 2e-35 phloem protein 2-A10 (.1) Potri.012G120340 [exp] 64 / 2e-13 AT1G10155 133 / 1e-39 phloem protein 2-A10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040607 [exp] 74 / 2e-16 AT2G39440 164 / 8e-50 unknown protein Lus10018300 [exp] 74 / 3e-16 AT2G39440 164 / 7e-50 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF14299 [poplar] [flax] PP2 Phloem protein 2
Representative CDS sequence Show only first row Show all	>Potri.015G119100.5 pacid=42776412 polypeptide=Potri.015G119100.5.p locus=Potri.015G119100 ID=Potri.015G119100.5.v4.1 annot-version=v4.1 ATGCCTGTGACCAAAGGGAAGACGTATGAAGTTAGCTTTATGTTATCCATGAACACAAAGAATTCCTTTGGCTGGGACGATCCTGTTACGGTGATGGCTA GGATAGGAAAGGAGGGAAAGTATCAGCGCAAAGAAATAAAACTATTAGACTTAAGCAAGGAAGTAGAGGAACGTCCTTCGGATAAGTGTCGGGTTGAGTT TGAAAAATCTGAAAGTAAAGAGGAACCTCGTGAGAAGAAGAGTCAGACTAAGTCTAAAAGTGATGAAAACGCTAAAAATGACGAGGAGACGCTCTATTTT GGCTTGTATGAAGTGTGGACTAACAAATGGAAGGGTGGTCTACGGATTCATGAGGCCATAGTTCAGGAAATACCAGCTGGGAATAATGCTTCTACATCTA ATTAA
AA sequence Show only first row Show all	>Potri.015G119100.5 pacid=42776412 polypeptide=Potri.015G119100.5.p locus=Potri.015G119100 ID=Potri.015G119100.5.v4.1 annot-version=v4.1 MPVTKGKTYEVSFMLSMNTKNSFGWDDPVTVMARIGKEGKYQRKEIKLLDLSKEVEERPSDKCRVEFEKSESKEEPREKKSQTKSKSDENAKNDEETLYF GLYEVWTNKWKGGLRIHEAIVQEIPAGNNASTSN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G31200		ATPP2-A9	phloem protein 2-A9 (.1)		Potri.015G119100 [exp]	0	1
					Potri.011G160250 [exp]	9.79	0.8331
					Potri.003G012451 [exp]	16.91	0.8199
AT4G36650		ATPBRP	plant-specific TFIIB-related p...		Potri.007G027600 [exp]	21.35	0.8303
AT4G27680			P-loop containing nucleoside t...		Potri.012G017760 [exp]	21.54	0.8179
AT1G14650			SWAP (Suppressor-of-White-APri...		Potri.007G070700 [exp]	23.76	0.8310
AT1G79060			unknown protein		Potri.007G065200 [exp]	25.88	0.8259
AT5G58270		ABCB25, ATATM3,...	STARIK 1, ARABIDOPSIS THALIANA...		Potri.013G160500 [exp]	26.83	0.7818	STA1.2
AT1G27410			DNA repair metallo-beta-lactam...		Potri.013G121700 [exp]	31.78	0.7426
AT1G17070			GC-rich sequence DNA-binding f...		Potri.019G043200 [exp]	33.40	0.8265
AT3G56680			Single-stranded nucleic acid b...		Potri.010G237500 [exp]	33.49	0.8220

Compare expression of checked genes

Potri.015G119100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.