Potri.015G119201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G120220 0 / 1 AT2G39440 183 / 5e-60 unknown protein
Potri.012G120100 0 / 1 AT2G39440 183 / 5e-60 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018300 41 / 1e-05 AT2G39440 164 / 7e-50 unknown protein
Lus10040607 41 / 1e-05 AT2G39440 164 / 8e-50 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0662 Triple_barrel PF08615 RNase_H2_suC Ribonuclease H2 non-catalytic subunit (Ylr154p-like)
Representative CDS sequence
>Potri.015G119201.1 pacid=42775027 polypeptide=Potri.015G119201.1.p locus=Potri.015G119201 ID=Potri.015G119201.1.v4.1 annot-version=v4.1
ATGATGGCCCTTCTGCCGTTTCTCACTGCTTCAAACCCAAACCCAAACCCACTGTTTTTGGGTGCTTTTGTAGGGGTAGAAATGGAGGGGATGAAAGTTG
AGGAAGCTTATTTTAGAGGCAGGAATTTACAAGGTGCCAGGTTTCCTATTCCAAATGGGTGTTCTGGTAACTATGTTATATTGCAAGGAATTGAAATATG
A
AA sequence
>Potri.015G119201.1 pacid=42775027 polypeptide=Potri.015G119201.1.p locus=Potri.015G119201 ID=Potri.015G119201.1.v4.1 annot-version=v4.1
MMALLPFLTASNPNPNPLFLGAFVGVEMEGMKVEEAYFRGRNLQGARFPIPNGCSGNYVILQGIEI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.015G119201 0 1
AT4G27220 NB-ARC domain-containing disea... Potri.019G002800 4.89 0.7058
AT4G27220 NB-ARC domain-containing disea... Potri.018G145578 6.92 0.7561
AT4G27220 NB-ARC domain-containing disea... Potri.018G145582 8.83 0.7522
AT5G36930 Disease resistance protein (TI... Potri.011G012000 12.96 0.7560
Potri.015G116750 17.49 0.6840
Potri.008G085150 27.29 0.7146
Potri.007G038800 30.69 0.7129
AT4G22730 Leucine-rich repeat protein ki... Potri.003G115100 39.93 0.6988
AT3G63380 ATPase E1-E2 type family prote... Potri.016G009400 45.36 0.7063
AT4G27220 NB-ARC domain-containing disea... Potri.018G136301 45.69 0.6983

Potri.015G119201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.